KEGG   Homo sapiens (human): 84152Help
Entry
84152             CDS       T01001                                 

Gene name
PPP1R1B, DARPP-32, DARPP32
Definition
protein phosphatase 1, regulatory (inhibitor) subunit 1B (EC:3.1.3.16)
Orthology
K15494  
protein phosphatase 1 regulatory subunit 1B
Organism
hsa  Homo sapiens (human)
Pathway
Dopaminergic synapse
Cocaine addiction
Amphetamine addiction
Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    84152 (PPP1R1B)
 Human Diseases
  Substance dependence
   05030 Cocaine addiction
    84152 (PPP1R1B)
   05031 Amphetamine addiction
    84152 (PPP1R1B)
   05034 Alcoholism
    84152 (PPP1R1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     84152 (PPP1R1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q12
AA seq 168 aa AA seqDB search
MLFRLSEHSSPEEEASPHQRASGEGHHLKSKRPNPCAYTPPSLKAVQRIAESHLQSISNL
NENQASEEEDELGELRELGYPREEDEEEEEDDEEEEEEEDSQAEVLKVIRQSAGQKTTCG
QGLEGPWERPPPLDESERDGGSEDQVEDPALSEPGEEPQRPSPSEPGT
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctgttccggctctcagagcactcctcaccagaggaggaagcctccccccaccagaga
gcctcaggagaggggcaccatctcaagtcgaagagacccaacccctgtgcctacacacca
ccttcgctgaaagctgtgcagcgcattgctgagtctcacctgcagtctatcagcaatttg
aatgagaaccaggcctcagaggaggaggatgagctgggggagcttcgggagctgggttat
ccaagagaggaagatgaggaggaagaggaggatgatgaagaagaggaagaagaagaggac
agccaggctgaagtcctgaaggtcatcaggcagtctgctgggcaaaagacaacctgtggc
cagggtctggaagggccctgggagcgcccaccccctctggatgagtccgagagagatgga
ggctctgaggaccaagtggaagacccagcactaagtgagcctggggaggaacctcagcgc
ccttccccctctgagcctggcacatag

DBGET integrated database retrieval system