KEGG   Homo sapiens (human): 84153Help
Entry
84153             CDS       T01001                                 

Gene name
RNASEH2C, AGS3, AYP1
Definition
ribonuclease H2, subunit C
Orthology
K10745  
ribonuclease H2 subunit C
Organism
hsa  Homo sapiens (human)
Pathway
DNA replication
Disease
H00290  
Aicardi-Goutieres Syndrome (AGS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    84153 (RNASEH2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.1
AA seq 164 aa AA seqDB search
MESGDEAAIERHRVHLRSATLRDAVPATLHLLPCEVAVDGPAPVGRFFTPAIRQGPEGLE
VSFRGRCLRGEEVAVPPGLVGYVMVTEEKKVSMGKPDPLRDSGTDDQEEEPLERDFDRFI
GATANFSRFTLWGLETIPGPDAKVRGALTWPSLAAAIHAQVPED
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggagagcggcgacgaagcggccatcgagaggcaccgcgtccacttgcgctccgccaca
ttgcgcgacgccgtacccgccacactgcatctgctgccctgcgaggttgcggtggacggg
cccgccccggtggggcgcttcttcacgcccgccatccgccagggccccgagggactcgaa
gtgtcgtttcggggccgctgtctacggggagaggaggtggcggtgccgcctggcctcgtg
ggatacgtgatggtgacagaagagaagaaggtgtcgatggggaagccagaccccttgcgg
gattccgggactgacgaccaagaggaggagccgctggagcgggacttcgaccgcttcatt
ggagccactgccaacttcagccgcttcaccctgtggggtctggagaccatccctggcccg
gatgccaaagtgcgtggggccttaacttggcccagccttgcggcagcgattcacgcacag
gtgcccgaggactga

DBGET integrated database retrieval system