KEGG   Homo sapiens (human): 84188Help
Entry
84188             CDS       T01001                                 

Gene name
FAR1, MLSTD2, SDR10E1
Definition
fatty acyl CoA reductase 1 (EC:1.2.1.n2)
Orthology
K13356  
fatty acyl-CoA reductase [EC:1.2.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Class
Metabolism; Lipid metabolism; Cutin, suberine and wax biosynthesis
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11p15.2
AA seq 515 aa AA seqDB search
MVSIPEYYEGKNVLLTGATGFLGKVLLEKLLRSCPKVNSVYVLVRQKAGQTPQERVEEVL
SGKLFDRLRDENPDFREKIIAINSELTQPKLALSEEDKEVIIDSTNIIFHCAATVRFNEN
LRDAVQLNVIATRQLILLAQQMKNLEVFMHVSTAYAYCNRKHIDEVVYPPPVDPKKLIDS
LEWMDDGLVNDITPKLIGDRPNTYIYTKALAEYVVQQEGAKLNVAIVRPSIVGASWKEPF
PGWIDNFNGPSGLFIAAGKGILRTIRASNNALADLVPVDVVVNMSLAAAWYSGVNRPRNI
MVYNCTTGSTNPFHWGEVEYHVISTFKRNPLEQAFRRPNVNLTSNHLLYHYWIAVSHKAP
AFLYDIYLRMTGRSPRMMKTITRLHKAMVFLEYFTSNSWVWNTENVNMLMNQLNPEDKKT
FNIDVRQLHWAEYIENYCLGTKKYVLNEEMSGLPAARKHLNKLRNIRYGFNTILVILIWR
IFIARSQMARNIWYFVVSLCYKFLSYFRASSTMRY
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaatcccagaatactatgaaggcaagaacgtcctcctcacaggagctaccggt
tttctagggaaggtgcttctggaaaagttgctgaggtcttgtcctaaggtgaattcagta
tatgttttggtgaggcagaaagctggacagacaccacaagagcgagtggaagaagtcctt
agtggcaagctttttgacagattgagagatgaaaatccagattttagagagaaaattata
gcaatcaacagcgaactcacccaacctaaactggctctcagtgaagaagataaagaggtg
atcatagattctaccaatattatattccactgtgcagctacagtaaggtttaatgaaaat
ttaagagatgctgttcagttaaatgtgattgcaacgcgacagcttattctccttgcacaa
caaatgaagaatctggaagtgttcatgcatgtatcaacagcatatgcctactgtaatcgc
aagcatattgatgaagtagtctatccaccacctgtggatcccaagaagctgattgattct
ttagagtggatggatgatggcctagtaaatgatatcacgccaaaattgataggagacaga
cctaatacatacatatacacaaaagcattggcagaatatgttgtacaacaagaaggagca
aaactaaatgtggcaattgtaaggccatcgattgttggtgccagttggaaagaacctttt
ccaggatggattgataactttaatggaccaagtggtctctttattgcggcagggaaagga
attcttcgaacaatacgtgcctccaacaatgcccttgcagatcttgttcctgtagatgta
gttgtcaacatgagtcttgcggcagcctggtattccggagttaatagaccaagaaacatc
atggtgtataattgtacaacaggcagcactaatcctttccactggggtgaagttgagtac
catgtaatttccactttcaagaggaatcctctcgaacaggccttcagacggcccaatgta
aatctaacctccaatcatcttttatatcattactggattgctgtaagccataaggcccca
gcattcctgtatgatatctacctcaggatgactggaagaagcccaaggatgatgaaaaca
ataactcgtcttcacaaagctatggtgtttcttgaatatttcacaagtaattcttgggtt
tggaatactgagaatgtcaatatgttaatgaatcaactaaaccctgaagataaaaagacc
ttcaatattgatgtacggcagttacattgggcagaatatatagagaactactgcttggga
actaagaagtacgtattgaatgaagaaatgtctggcctccctgcagccagaaaacatctg
aacaagttgcggaatatacgttatggttttaatactatccttgtgatcctcatctggcgc
atttttattgcaagatcacaaatggcaagaaatatctggtactttgtggttagtctgtgt
tacaagtttttgtcatacttccgagcatccagcactatgagatactga

DBGET integrated database retrieval system