KEGG   Homo sapiens (human): 84196Help
Entry
84196             CDS       T01001                                 

Gene name
USP48, RAP1GA1, USP31
Definition
(RefSeq) ubiquitin specific peptidase 48 (EC:3.4.19.12)
  KO
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     84196 (USP48)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   84196 (USP48)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    84196 (USP48)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.12
AA seq 1035 aa AA seqDB search
MAPRLQLEKAAWRWAETVRPEEVSQEHIETAYRIWLEPCIRGVCRRNCKGNPNCLVGIGE
HIWLGEIDENSFHNIDDPNCERRKKNSFVGLTNLGATCYVNTFLQVWFLNLELRQALYLC
PSTCSDYMLGDGIQEEKDYEPQTICEHLQYLFALLQNSNRRYIDPSGFVKALGLDTGQQQ
DAQEFSKLFMSLLEDTLSKQKNPDVRNIVQQQFCGEYAYVTVCNQCGRESKLLSKFYELE
LNIQGHKQLTDCISEFLKEEKLEGDNRYFCENCQSKQNATRKIRLLSLPCTLNLQLMRFV
FDRQTGHKKKLNTYIGFSEILDMEPYVEHKGGSYVYELSAVLIHRGVSAYSGHYIAHVKD
PQSGEWYKFNDEDIEKMEGKKLQLGIEEDLAEPSKSQTRKPKCGKGTHCSRNAYMLVYRL
QTQEKPNTTVQVPAFLQELVDRDNSKFEEWCIEMAEMRKQSVDKGKAKHEEVKELYQRLP
AGAEPYEFVSLEWLQKWLDESTPTKPIDNHACLCSHDKLHPDKISIMKRISEYAADIFYS
RYGGGPRLTVKALCKECVVERCRILRLKNQLNEDYKTVNNLLKAAVKGSDGFWVGKSSLR
SWRQLALEQLDEQDGDAEQSNGKMNGSTLNKDESKEERKEEEELNFNEDILCPHGELCIS
ENERRLVSKEAWSKLQQYFPKAPEFPSYKECCSQCKILEREGEENEALHKMIANEQKTSL
PNLFQDKNRPCLSNWPEDTDVLYIVSQFFVEEWRKFVRKPTRCSPVSSVGNSALLCPHGG
LMFTFASMTKEDSKLIALIWPSEWQMIQKLFVVDHVIKITRIEVGDVNPSETQYISEPKL
CPECREGLLCQQQRDLREYTQATIYVHKVVDNKKVMKDSAPELNVSSSETEEDKEEAKPD
GEKDPDFNQSNGGTKRQKISHQNYIAYQKQVIRRSMRHRKVRGEKALLVSANQTLKELKI
QIMHAFSVAPFDQNLSIDGKILSDDCATLGTLGVIPESVILLKADEPIADYAAMDDVMQV
CMPEEGFKGTGLLGH
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atggccccgcggctgcagctggagaaggcggcctggcgctgggcggagacggtgcggccc
gaggaggtgtcgcaggagcacatcgagaccgcttaccgcatctggctggagccctgcatt
cgcggcgtgtgcagacgaaactgcaaaggaaatccgaattgcttggttggtattggtgag
catatttggttaggagaaatagatgaaaatagttttcataacatcgatgatcccaactgt
gagaggagaaaaaagaactcatttgtgggcctgactaaccttggagccacttgttatgtc
aacacatttcttcaagtgtggtttctcaacttggagcttcggcaggcactctacttatgt
ccaagcacttgtagtgactacatgctgggagacggcatccaagaagaaaaagattatgag
cctcaaacaatttgtgagcatctccagtacttgtttgccttgttgcaaaacagtaatagg
cgatacattgatccatcaggatttgttaaagccttgggcctggacactggacaacagcag
gatgctcaagaattttcaaagctctttatgtctctattggaagatactttgtctaaacaa
aagaatccagatgtgcgcaatattgttcaacagcagttctgtggagaatatgcctatgta
actgtttgcaaccagtgtggcagagagtctaagcttttgtcaaaattttatgagctggag
ttaaatatccaaggccacaaacagttaacagattgtatctcggaatttttgaaggaagaa
aaattagaaggagacaatcgctatttttgcgagaactgtcaaagcaaacagaatgcaaca
agaaagattcgacttcttagccttccttgcactctgaacttgcagctaatgcgttttgtc
tttgacaggcaaactggacataagaaaaagctgaatacctacattggcttctcagaaatt
ttggatatggagccttatgtggaacataaaggtgggtcctacgtgtatgaactcagcgca
gtcctcatacacagaggagtgagtgcttattctggccactacatcgcccacgtgaaagat
ccacagtctggtgaatggtataagtttaatgatgaagacatagaaaagatggaggggaag
aaattacaactagggattgaggaagatctagcagaaccttctaagtctcagacacgtaaa
cccaagtgtggcaaaggaactcattgctctcgaaatgcatatatgttggtttatagactg
caaactcaagaaaagcccaacactactgttcaagttccagcctttcttcaagagctggta
gatcgggataattccaaatttgaggagtggtgtattgaaatggctgagatgcgtaagcaa
agtgtggataaaggaaaagcaaaacacgaagaggttaaggagctgtaccaaaggttacct
gctggagctgagccctatgagtttgtctctctggaatggctgcaaaagtggttggatgaa
tcaacacctaccaaacctattgataatcacgcttgcctgtgttcccatgacaagcttcac
ccggataaaatatcaattatgaagaggatatctgaatatgcagctgacattttctatagt
agatatggaggaggtccaagactaactgtgaaagccctgtgtaaggaatgtgtagtagaa
cgttgtcgcatattgcgtctgaagaaccaactaaatgaagattataaaactgttaataat
ctgctgaaagcagcagtaaagggcagcgatggattttgggtggggaagtcctccttgcgg
agttggcgccagctagctcttgaacagctggatgagcaagatggtgatgcagaacaaagc
aacggaaagatgaacggtagcaccttaaataaagatgaatcaaaggaagaaagaaaagaa
gaggaggaattaaattttaatgaagatattctgtgtccacatggtgagttatgcatatct
gaaaatgaaagaaggcttgtttctaaagaggcttggagcaaactgcagcagtactttcca
aaggctcctgagtttccaagttacaaagagtgctgttcacagtgcaagattttagaaaga
gaaggggaagaaaatgaagccttacataagatgattgcaaacgagcaaaagacttctctc
ccaaatttgttccaggataaaaacagaccgtgtctcagtaactggccagaggatacggat
gtcctctacatcgtgtctcagttctttgtagaagagtggcggaaatttgttagaaagcct
acaagatgcagccctgtgtcatcagttgggaacagtgctcttttgtgtccccacgggggc
ctcatgtttacatttgcttccatgaccaaagaagattctaaacttatagctctcatatgg
cccagtgagtggcaaatgatacaaaagctctttgttgtggatcatgtaattaaaatcacg
agaattgaagtgggagatgtaaacccttcagaaacacagtatatttctgagcccaaactc
tgtccagaatgcagagaaggcttattgtgtcagcagcagagggacctgcgtgaatacact
caagccaccatctatgtccataaagttgtggataataaaaaggtgatgaaggattcggct
ccggaactgaatgtgagtagttctgaaacagaggaggacaaggaagaagctaaaccagat
ggagaaaaagatccagattttaatcaaagcaatggtggaacaaagcggcaaaagatatcc
catcaaaattatatagcctatcaaaagcaagttattcgccgaagtatgcgacatagaaaa
gttcgtggtgagaaagcacttctcgtttctgctaatcagacgttaaaagaattgaaaatt
cagatcatgcatgcattttcagttgctccttttgaccagaatttgtcaattgatggaaag
attttaagtgatgactgtgccaccctaggcacccttggcgtcattcctgaatctgtcatt
ttattgaaggctgatgaaccaattgcagattatgctgcaatggatgatgtcatgcaagtt
tgtatgccagaagaagggtttaaaggtactggtcttcttggacattaa

DBGET integrated database retrieval system