KEGG   Homo sapiens (human): 8424Help
Entry
8424              CDS       T01001                                 

Gene name
BBOX1, BBH, BBOX, G-BBH, gamma-BBH
Definition
butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1 (EC:1.14.11.1)
Orthology
K00471  
gamma-butyrobetaine dioxygenase [EC:1.14.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    8424 (BBOX1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.1  gamma-butyrobetaine dioxygenase
     8424 (BBOX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p14.2
AA seq 387 aa AA seqDB search
MACTIQKAEALDGAHLMQILWYDEEESLYPAVWLRDNCPCSDCYLDSAKARKLLVEALDV
NIGIKGLIFDRKKVYITWPDEHYSEFQADWLKKRCFSKQARAKLQRELFFPECQYWGSEL
QLPTLDFEDVLRYDEHAYKWLSTLKKVGIVRLTGASDKPGEVSKLGKRMGFLYLTFYGHT
WQVQDKIDANNVAYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQK
LKKNNPQAFQILSSTFVDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTIF
DVPVERVQPFYAALKEFVDLMNSKESKFTFKMNPGDVITFDNWRLLHGRRSYEAGTEISR
HLEGAYADWDVVMSRLRILRQRVENGN
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtaccatccaaaaggcagaagcacttgacggggctcatttgatgcagatcctc
tggtatgatgaggaagagtctctctacccagctgtatggttgagagacaactgtccgtgc
tctgattgctacctggattctgcaaaagcacggaaacttctagtggaagctcttgatgtg
aacattggaattaaaggcttgatatttgacagaaaaaaggtgtacatcacatggcccgat
gagcattacagtgaattccaggctgattggctgaagaaaagatgcttttccaagcaggcc
agagcaaagctccaaagagaattgttttttccagaatgccaatactggggctcagagctc
cagctacccactttggattttgaagatgttttaagatatgatgaacacgcatacaagtgg
ctctccaccctcaagaaagtaggcatagtaagactcaccggagcatctgacaaaccagga
gaagtttcaaaacttgggaaaaggatgggtttcctctatctcacattttatggacatact
tggcaagtgcaagacaaaatcgatgcaaacaatgtggcttacacaactgggaagctaagc
tttcacactgattatccagccctccatcatccacctggggttcagcttcttcactgcata
aagcaaacagtcacagggggtgattcagaaattgtagatgggtttaatgtgtgccaaaaa
ctaaagaaaaataatcctcaggcattccagattttgtcctctacctttgtggactttaca
gacattggagtggattactgtgatttttctgtacaatcaaaacataaaattatagagtta
gatgataaaggccaagtggttcgcatcaacttcaataacgcaactagggacacaatattt
gatgtgcctgttgaaagagttcagcctttttatgctgctctgaaggagtttgttgacctc
atgaacagcaaagaatccaagtttaccttcaagatgaatccaggtgatgtgattactttt
gataactggcgcttacttcatggccgacgtagctatgaagcaggaactgagatatcccgc
catctagaaggagcttatgctgactgggatgtggtcatgtcaaggcttcgtatcttaagg
cagagggtggagaatggaaactga

DBGET integrated database retrieval system