KEGG   Homo sapiens (human): 84245Help
Entry
84245             CDS       T01001                                 

Gene name
MRI1, MRDI, MTNA, Ypr118w
Definition
methylthioribose-1-phosphate isomerase 1 (EC:5.3.1.23)
Orthology
K08963  
methylthioribose-1-phosphate isomerase [EC:5.3.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:hsa00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.2
AA seq 369 aa AA seqDB search
MTLEAIRYSRGSLQILDQLLLPKQSRYEAVGSVHQAWEAIRAMKVRGAPAIALVGCLSLA
VELQAGAGGPGLAALVAFVRDKLSFLVTARPTAVNMARAARDLADVAAREAEREGATEEA
VRERVICCTEDMLEKDLRDNRSIGDLGARHLLERVAPSGGKVTVLTHCNTGALATAGYGT
ALGVIRSLHSLGRLEHAFCTETRPYNQGARLTAFELVYEQIPATLITDSMVAAAMAHRGV
SAVVVGADRVVANGDTANKVGTYQLAIVAKHHGIPFYVAAPSSSCDLRLETGKEIIIEER
PGQELTDVNGVRIAAPGIGVWNPAFDVTPHDLITGGIITELGVFAPEELRTALTTTISSR
DGTLDGPQM
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaccctggaggcgatccgctactcgcggggctccctgcagatcctagaccagctgctg
ctgcccaagcagagccgctacgaggcggtgggctcggtgcaccaggcctgggaggccatc
cgcgccatgaaggtgcggggcgccccggccatagccctggtgggctgtctcagcctcgcc
gtggagctgcaggcgggcgccgggggaccgggactcgccgcgctcgtggccttcgtgcgc
gacaagctgagcttcctcgtcaccgcccggcccaccgctgtcaacatggcccgcgccgcc
cgcgacctggctgatgttgcagcccgggaggccgaacgggagggcgctacggaagaggcg
gtccgggagagagtgatctgctgcaccgaggacatgctggagaaagacctcagagacaac
cgaagcattggggacctaggagcccgccacctcctggagcgggtggcccccagcggtggc
aaggtgactgtgctgacccactgtaacactggtgctctggccaccgctggctatggtaca
gccctaggtgtgattcgctcactgcacagcctgggccgcctggagcatgccttctgcaca
gagacccggccctacaaccagggagcccggctgacggcctttgagctggtctatgagcag
atccccgccacccttatcaccgacagcatggtggctgctgccatggcccataggggcgtg
tcagctgtggtcgtgggagctgaccgcgtggttgccaacggcgacacagccaacaaggtg
ggcacctaccagctggccattgtcgccaagcaccatggcattcccttctacgtggctgcc
cccagctcttcatgtgacctccgtctggagaccggcaaggagatcattattgaagagcga
ccgggccaggagctgaccgatgttaatggggtccggattgcagcacctgggattggagtt
tggaatcctgccttcgatgtcaccccccacgacctcatcactggtggcatcatcacagaa
ctgggggtctttgcccctgaggagctccggacagccctaaccaccaccatctcttccagg
gatggaaccctagatggaccccagatgtaa

DBGET integrated database retrieval system