KEGG   Homo sapiens (human): 84253Help
Entry
84253             CDS       T01001                                 

Gene name
GARNL3, bA356B19.1
Definition
(RefSeq) GTPase activating Rap/RanGAP domain like 3
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.3
AA seq 1013 aa AA seqDB search
MVVDFCRRFVARSLCIILMKHFCSSSVSEDLGCRRGDFSRKHYGSVELLISSDADGAIQR
AGRFRVENGSSDENATALPGTWRRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSP
FFLSVTLSDQNNQRVPQYRAILWRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPR
EIFHPEIQKDLLVLEEQEGSVNFKFGVLFAKDGQLTDDEMFSNEIGSEPFQKFLNLLGDT
ITLKGWTGYRGGLDTKNDTTGIHSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGN
DIVTIVFQEGEESSPAFKPSMIRSHFTHIFALVRYNQQNDNYRLKIFSEESVPLFGPPLP
TPPVFTDHQEFRDFLLVKLINGEKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNML
NRRSFSDVLPESPKSARKKEEARQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWE
PQCFCSNFPHEAVCADPWGQALLVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDL
LVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRE
LRIVVAIRNKLLLITRKHNKPSGVTSTSLLSPLSESPVEEFQYIREICLSDSPMVMTLVD
GPAEESDNLICVAYRHQFDVVNESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYN
YSCIYKKVCPFNGGSFLVQPSASDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGN
LVHTAVVPQLQLVASRSDIYFTATAAVNEVSSGGSSKGASARNSPQTPPGRDTPVFPSSL
GEGEIQSKNLYKIPLRNLVGRSIERPLKSPLVSKVITPPTPISVGLAAIPVTHSLSLSRM
EIKEIASRTRRELLGLSDEGGPKSEGAPKAKSKPRKRLEESQGGPKPGAVRSSSSDRIPS
GSLESASTSEANPEGHSASSDQDPVADREGSPVSGSSPFQLTAFSDEDIIDLK
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atggtagttgatttttgcagaaggtttgtggccagatcgctatgtataatactgatgaag
catttttgttccagctctgtctcggaagacctaggctgtagacgtggggatttcagtagg
aaacattatggatctgtggagctgcttatttccagtgatgctgatggagccatccaaagg
gctggaagattcagagtggaaaatggctcttcagatgagaatgcaactgccctgcctggt
acttggcgaagaacagacgtgcacttagagaacccagaataccacaccagatggtatttc
aaatattttttaggacaagtccatcagaactacattggaaacgatgccgagaagagccct
ttcttcttgtccgtgaccctttctgaccaaaacaatcaacgtgtccctcaataccgtgca
attctttggagaaaaacaggtacccagaaaatatgccttccctacagtcccacaaaaact
ctttctgtgaagtccatcttaagtgccatgaatctggacaaatttgagaaaggccccagg
gaaatttttcatcctgaaatacaaaaggacttgctggttcttgaagaacaagagggctct
gtgaatttcaagtttggggttctttttgccaaagatgggcagctcactgatgatgagatg
ttcagcaatgaaattggaagcgagccttttcaaaaatttttaaatcttctgggtgacaca
atcactctaaagggctggacgggctaccgtggcggtctggataccaaaaatgataccaca
gggatacattcagtttatactgtgtaccaagggcatgagatcatgtttcatgtttccacc
atgttgccatattccaaagagaacaaacagcaggtggaaaggaaacgccacattggaaac
gatatcgtcaccattgtgttccaagaaggagaggaatcttctcctgcctttaagccttcc
atgatccgctcccactttacacatatttttgccttagtgagatacaatcaacaaaatgac
aattacaggctgaaaatattttcagaagagagcgtaccactctttggccctcccttgcca
actccaccagtgtttacagaccaccaggaattcagggactttttgctagtgaaattaatt
aatggtgaaaaagccactttggaaaccccaacatttgcccagaaacgtcggcgtaccctg
gatatgttgattagatctttacaccaggatttgatgccagatttgcataagaacatgctt
aatagacgatcttttagtgatgtcttaccagagtcacccaagtcagcgcggaagaaagag
gaggcccgccaggcggagtttgttagaatagggcaggcactaaaactgaaatccattgtg
agaggggatgctccatcaagcttggcagcttcagggatctgtaaaaaagagccgtgggag
ccccagtgtttctgcagtaatttccctcatgaagccgtgtgtgcagatccctggggccag
gccttgctggtttccactgatgctggcgtcttgctagtggatgatgaccttccatcagtg
cccgtgtttgacagaactctgccagtgaagcaaatgcatgtgcttgagaccctggacctt
ctggttctcagagcagacaaaggaaaagatgctcgcctctttgtcttcaggctaagtgct
ctgcaaaagggccttgaggggaagcaggctgggaagagcaggtctgactgcagagaaaac
aagttggagaaaacaaaaggctgccacctgtatgctattaacactcaccacagcagagag
ctgaggattgtggttgcaattcggaataaactgcttctgatcacaagaaaacacaacaag
ccaagcggggtcaccagcacctcattgttatctcccctgtctgagtcacctgttgaagaa
ttccagtacatcagggagatctgtctgtctgactctcccatggtgatgaccttagtggat
gggccagctgaagagagtgacaatctcatctgtgtggcttatcgacaccaatttgatgtg
gtgaatgagagcacaggagaagccttcaggctgcaccacgtggaggccaacagggttaat
tttgttgcagctattgatgtgtacgaagatggagaagctggtttgctgttgtgttacaac
tacagttgcatctataaaaaggtttgcccctttaatggtggctcttttttggttcaacct
tctgcgtcagatttccagttctgttggaaccaggctccctatgcaattgtctgtgctttc
ccgtatctcctggccttcaccaccgactccatggagatccgcctggtggtgaacgggaac
ctggtccacactgcagtcgtgccgcagctgcagctggtggcctccaggtcggatatatac
ttcacagcaactgcagctgtgaatgaggtctcatctggaggcagctccaagggggccagt
gcccgaaattctcctcagacacccccgggccgagatactccagtatttccttcttccctg
ggggaaggtgaaattcaatcaaaaaatctgtacaagattccacttagaaacctcgtgggc
agaagcatcgaacgacctctgaagtcacccttagtctccaaggtcatcaccccacccact
cccatcagtgtgggccttgctgccattccagtcacgcactccttgtccctgtctcgcatg
gagatcaaagaaatagcaagcaggacccgcagggaactactgggcctctcggatgaaggt
ggacccaagtcagaaggagcgccaaaggccaaatcaaaaccccggaagcggttagaagaa
agccaaggaggccccaagccaggggcagtgaggtcatctagcagtgacaggatcccatca
ggctccttggaaagtgcttctacttccgaagccaaccctgaggggcactcagccagctct
gaccaggaccctgtggcagacagagagggcagcccggtctccggcagcagccccttccag
ctcacggctttctccgatgaagacattatagacttgaagtaa

DBGET integrated database retrieval system