KEGG   Homo sapiens (human): 84253Help
Entry
84253             CDS       T01001                                 

Gene name
GARNL3, bA356B19.1
Definition
GTPase activating Rap/RanGAP domain-like 3
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q33.3
AA seq 991 aa AA seqDB search
MKSSVSEDLGCRRGDFSRKHYGSVELLISSDADGAIQRAGRFRVENGSSDENATALPGTW
RRTDVHLENPEYHTRWYFKYFLGQVHQNYIGNDAEKSPFFLSVTLSDQNNQRVPQYRAIL
WRKTGTQKICLPYSPTKTLSVKSILSAMNLDKFEKGPREIFHPEIQKDLLVLEEQEGSVN
FKFGVLFAKDGQLTDDEMFSNEIGSEPFQKFLNLLGDTITLKGWTGYRGGLDTKNDTTGI
HSVYTVYQGHEIMFHVSTMLPYSKENKQQVERKRHIGNDIVTIVFQEGEESSPAFKPSMI
RSHFTHIFALVRYNQQNDNYRLKIFSEESVPLFGPPLPTPPVFTDHQEFRDFLLVKLING
EKATLETPTFAQKRRRTLDMLIRSLHQDLMPDLHKNMLNRRSFSDVLPESPKSARKKEEA
RQAEFVRIGQALKLKSIVRGDAPSSLAASGICKKEPWEPQCFCSNFPHEAVCADPWGQAL
LVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQ
KGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHSRELRIVVAIRNKLLLITRKHNKPS
GVTSTSLLSPLSESPVEEFQYIREICLSDSPMVMTLVDGPAEESDNLICVAYRHQFDVVN
ESTGEAFRLHHVEANRVNFVAAIDVYEDGEAGLLLCYNYSCIYKKVCPFNGGSFLVQPSA
SDFQFCWNQAPYAIVCAFPYLLAFTTDSMEIRLVVNGNLVHTAVVPQLQLVASRSDIYFT
ATAAVNEVSSGGSSKGASARNSPQTPPGRDTPVFPSSLGEGEIQSKNLYKIPLRNLVGRS
IERPLKSPLVSKVITPPTPISVGLAAIPVTHSLSLSRMEIKEIASRTRRELLGLSDEGGP
KSEGAPKAKSKPRKRLEESQGGPKPGAVRSSSSDRIPSGSLESASTSEANPEGHSASSDQ
DPVADREGSPVSGSSPFQLTAFSDEDIIDLK
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagctctgtctcggaagacctaggctgtagacgtggggatttcagtaggaaacat
tatggatctgtggagctgcttatttccagtgatgctgatggagccatccaaagggctgga
agattcagagtggaaaatggctcttcagatgagaatgcaactgccctgcctggtacttgg
cgaagaacagacgtgcacttagagaacccagaataccacaccagatggtatttcaaatat
tttttaggacaagtccatcagaactacattggaaacgatgccgagaagagccctttcttc
ttgtccgtgaccctttctgaccaaaacaatcaacgtgtccctcaataccgtgcaattctt
tggagaaaaacaggtacccagaaaatatgccttccctacagtcccacaaaaactctttct
gtgaagtccatcttaagtgccatgaatctggacaaatttgagaaaggccccagggaaatt
tttcatcctgaaatacaaaaggacttgctggttcttgaagaacaagagggctctgtgaat
ttcaagtttggggttctttttgccaaagatgggcagctcactgatgatgagatgttcagc
aatgaaattggaagcgagccttttcaaaaatttttaaatcttctgggtgacacaatcact
ctaaagggctggacgggctaccgtggcggtctggataccaaaaatgataccacagggata
cattcagtttatactgtgtaccaagggcatgagatcatgtttcatgtttccaccatgttg
ccatattccaaagagaacaaacagcaggtggaaaggaaacgccacattggaaacgatatc
gtcaccattgtgttccaagaaggagaggaatcttctcctgcctttaagccttccatgatc
cgctcccactttacacatatttttgccttagtgagatacaatcaacaaaatgacaattac
aggctgaaaatattttcagaagagagcgtaccactctttggccctcccttgccaactcca
ccagtgtttacagaccaccaggaattcagggactttttgctagtgaaattaattaatggt
gaaaaagccactttggaaaccccaacatttgcccagaaacgtcggcgtaccctggatatg
ttgattagatctttacaccaggatttgatgccagatttgcataagaacatgcttaataga
cgatcttttagtgatgtcttaccagagtcacccaagtcagcgcggaagaaagaggaggcc
cgccaggcggagtttgttagaatagggcaggcactaaaactgaaatccattgtgagaggg
gatgctccatcaagcttggcagcttcagggatctgtaaaaaagagccgtgggagccccag
tgtttctgcagtaatttccctcatgaagccgtgtgtgcagatccctggggccaggccttg
ctggtttccactgatgctggcgtcttgctagtggatgatgaccttccatcagtgcccgtg
tttgacagaactctgccagtgaagcaaatgcatgtgcttgagaccctggaccttctggtt
ctcagagcagacaaaggaaaagatgctcgcctctttgtcttcaggctaagtgctctgcaa
aagggccttgaggggaagcaggctgggaagagcaggtctgactgcagagaaaacaagttg
gagaaaacaaaaggctgccacctgtatgctattaacactcaccacagcagagagctgagg
attgtggttgcaattcggaataaactgcttctgatcacaagaaaacacaacaagccaagc
ggggtcaccagcacctcattgttatctcccctgtctgagtcacctgttgaagaattccag
tacatcagggagatctgtctgtctgactctcccatggtgatgaccttagtggatgggcca
gctgaagagagtgacaatctcatctgtgtggcttatcgacaccaatttgatgtggtgaat
gagagcacaggagaagccttcaggctgcaccacgtggaggccaacagggttaattttgtt
gcagctattgatgtgtacgaagatggagaagctggtttgctgttgtgttacaactacagt
tgcatctataaaaaggtttgcccctttaatggtggctcttttttggttcaaccttctgcg
tcagatttccagttctgttggaaccaggctccctatgcaattgtctgtgctttcccgtat
ctcctggccttcaccaccgactccatggagatccgcctggtggtgaacgggaacctggtc
cacactgcagtcgtgccgcagctgcagctggtggcctccaggtcggatatatacttcaca
gcaactgcagctgtgaatgaggtctcatctggaggcagctccaagggggccagtgcccga
aattctcctcagacacccccgggccgagatactccagtatttccttcttccctgggggaa
ggtgaaattcaatcaaaaaatctgtacaagattccacttagaaacctcgtgggcagaagc
atcgaacgacctctgaagtcacccttagtctccaaggtcatcaccccacccactcccatc
agtgtgggccttgctgccattccagtcacgcactccttgtccctgtctcgcatggagatc
aaagaaatagcaagcaggacccgcagggaactactgggcctctcggatgaaggtggaccc
aagtcagaaggagcgccaaaggccaaatcaaaaccccggaagcggttagaagaaagccaa
ggaggccccaagccaggggcagtgaggtcatctagcagtgacaggatcccatcaggctcc
ttggaaagtgcttctacttccgaagccaaccctgaggggcactcagccagctctgaccag
gaccctgtggcagacagagagggcagcccggtctccggcagcagccccttccagctcacg
gctttctccgatgaagacattatagacttgaagtaa

DBGET integrated database retrieval system