KEGG   Homo sapiens (human): 843Help
Entry
843               CDS       T01001                                 

Gene name
CASP10, ALPS2, FLICE2, MCH4
Definition
caspase 10, apoptosis-related cysteine peptidase (EC:3.4.22.63)
Orthology
K04400  
caspase 10 [EC:3.4.22.63]
Organism
hsa  Homo sapiens (human)
Pathway
Apoptosis
RIG-I-like receptor signaling pathway
TNF signaling pathway
Tuberculosis
Hepatitis B
Disease
H00108  
Autoimmune lymphoproliferative syndromes (ALPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    843 (CASP10)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    843 (CASP10)
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    843 (CASP10)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    843 (CASP10)
   05161 Hepatitis B
    843 (CASP10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.63  caspase-10
     843 (CASP10)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C14: caspase family
   843 (CASP10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q33-q34
AA seq 455 aa AA seqDB search
MKSQGQHWYSSSDKNCKVSFREKLLIIDSNLGVQDVENLKFLCIGLVPNKKLEKSSSASD
VFEHLLAEDLLSEEDPFFLAELLYIIRQKKLLQHLNCTKEEVERLLPTRQRVSLFRNLLY
ELSEGIDSENLKDMIFLLKDSLPKTEMTSLSFLAFLEKQGKIDEDNLTCLEDLCKTVVPK
LLRNIEKYKREKAIQIVTPPVDKEAESYQGEEELVSQTDVKTFLEALPQESWQNKHAGSN
EILSHVFQWLGFTVHIHNNVTKVEMEMVLQKQKCNPAHADGDCFVFCILTHGRFGAVYSS
DEALIPIREIMSHFTALQCPRLAEKPKLFFIQACQGEEIQPSVSIEADALNPEQAPTSLQ
DSIPAEADFLLGLATVPGYVSFRHVEEGSWYIQSLCNHLKKLVPRHEDILSILTAVNDDV
SRRVDKQGTKKQMPQPAFTLRKKLVFPVPLDALSL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcaaggtcaacattggtattccagttcagataaaaactgtaaagtgagcttt
cgtgagaagcttctgattattgattcaaacctgggggtccaagatgtggagaacctcaag
tttctctgcataggattggtccccaacaagaagctggagaagtccagctcagcctcagat
gtttttgaacatctcttggcagaggatctgctgagtgaggaagaccctttcttcctggca
gaactcctctatatcatacggcagaagaagctgctgcagcacctcaactgtaccaaagag
gaagtggagcgactgctgcccacccgacaaagggtttctctgtttagaaacctgctctac
gaactgtcagaaggcattgactcagagaacttaaaggacatgatcttccttctgaaagac
tcgcttcccaaaactgaaatgacctccctaagtttcctggcatttctagagaaacaaggt
aaaatagatgaagataatctgacatgcctggaggacctctgcaaaacagttgtacctaaa
cttttgagaaacatagagaaatacaaaagagagaaagctatccagatagtgacacctcct
gtagacaaggaagccgagtcgtatcaaggagaggaagaactagtttcccaaacagatgtt
aagacattcttggaagccttaccgcaggagtcctggcaaaataagcatgcaggtagtaat
gagatcctgagtcatgtgttccagtggcttgggttcacagtgcatatacacaataatgtg
acgaaagtggaaatggagatggtcctgcagaagcagaagtgcaatccagcccatgccgac
ggggactgcttcgtgttctgtattctgacccatgggagatttggagctgtctactcttcg
gatgaggccctcattcccattcgggagatcatgtctcacttcacagccctgcagtgccct
agactggctgaaaaacctaaactctttttcatccaggcctgccaaggtgaagagatacag
ccttccgtatccatcgaagcagatgctctgaaccctgagcaggcacccacttccctgcag
gacagtattcctgccgaggctgacttcctacttggtctggccactgtcccaggctatgta
tcctttcggcatgtggaggaaggcagctggtatattcagtctctgtgtaatcatctgaag
aaattggtcccaagacatgaagacatcttatccatcctcactgctgtcaacgatgatgtg
agtcgaagagtggacaaacagggaacaaagaaacagatgccccagcctgctttcacacta
aggaaaaaactagtattccctgtgcccctggatgcactttcattatag

  All links  
No link information was found.   
DBGET integrated database retrieval system