KEGG   Homo sapiens (human): 8431Help
Entry
8431              CDS       T01001                                 

Gene name
NR0B2, SHP, SHP1
Definition
nuclear receptor subfamily 0, group B, member 2
Orthology
K08563  
nuclear receptor subfamily 0 group B member 2
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04976 Bile secretion
    8431 (NR0B2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Knirps/DAX 1-like
    8431 (NR0B2)
Nuclear receptors [BR:hsa03310]
 0. Knirps / DAX like
  0B. DAX like receptor
   8431 (NR0B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.1
AA seq 257 aa AA seqDB search
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP
GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI
IGDVDIAGLLGDMLLLR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagccaaccaggggcctgcccatgccagggagctgcaagccgccccgccatt
ctctacgcacttctgagctccagcctcaaggctgtcccccgaccccgtagccgctgccta
tgtaggcagcaccggcccgtccagctatgtgcacctcatcgcacctgccgggaggccttg
gatgttctggccaagacagtggccttcctcaggaacctgccatccttctggcagctgcct
ccccaggaccagcggcggctgctgcagggttgctggggccccctcttcctgcttgggttg
gcccaagatgctgtgacctttgaggtggctgaggccccggtgcccagcatactcaagaag
attctgctggaggagcccagcagcagtggaggcagtggccaactgccagacagaccccag
ccctccctggctgcggtgcagtggcttcaatgctgtctggagtccttctggagcctggag
cttagccccaaggaatatgcctgcctgaaagggaccatcctcttcaaccccgatgtgcca
ggcctccaagccgcctcccacattgggcacctgcagcaggaggctcactgggtgctgtgt
gaagtcctggaaccctggtgcccagcagcccaaggccgcctgacccgtgtcctcctcacg
gcctccaccctcaagtccattccgaccagcctgcttggggacctcttctttcgccctatc
attggagatgttgacatcgctggccttcttggggacatgcttttgctcaggtga

DBGET integrated database retrieval system