KEGG   Homo sapiens (human): 8431Help
Entry
8431              CDS       T01001                                 

Gene name
NR0B2, SHP, SHP1
Definition
nuclear receptor subfamily 0, group B, member 2
Orthology
K08563  
nuclear receptor subfamily 0 group B member 2
Organism
hsa  Homo sapiens (human)
Pathway
Bile secretion
Class
Organismal Systems; Digestive system; Bile secretion [PATH:hsa04976]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.1
AA seq 257 aa AA seqDB search
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLCAPHRTCREAL
DVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGLAQDAVTFEVAEAPVPSILKK
ILLEEPSSSGGSGQLPDRPQPSLAAVQWLQCCLESFWSLELSPKEYACLKGTILFNPDVP
GLQAASHIGHLQQEAHWVLCEVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPI
IGDVDIAGLLGDMLLLR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccagccaaccaggggcctgcccatgccagggagctgcaagccgccccgccatt
ctctacgcacttctgagctccagcctcaaggctgtcccccgaccccgtagccgctgccta
tgtaggcagcaccggcccgtccagctatgtgcacctcatcgcacctgccgggaggccttg
gatgttctggccaagacagtggccttcctcaggaacctgccatccttctggcagctgcct
ccccaggaccagcggcggctgctgcagggttgctggggccccctcttcctgcttgggttg
gcccaagatgctgtgacctttgaggtggctgaggccccggtgcccagcatactcaagaag
attctgctggaggagcccagcagcagtggaggcagtggccaactgccagacagaccccag
ccctccctggctgcggtgcagtggcttcaatgctgtctggagtccttctggagcctggag
cttagccccaaggaatatgcctgcctgaaagggaccatcctcttcaaccccgatgtgcca
ggcctccaagccgcctcccacattgggcacctgcagcaggaggctcactgggtgctgtgt
gaagtcctggaaccctggtgcccagcagcccaaggccgcctgacccgtgtcctcctcacg
gcctccaccctcaagtccattccgaccagcctgcttggggacctcttctttcgccctatc
attggagatgttgacatcgctggccttcttggggacatgcttttgctcaggtga

DBGET integrated database retrieval system