KEGG   Homo sapiens (human): 84313Help
Entry
84313             CDS       T01001                                 

Gene name
VPS25, DERP9, EAP20, FAP20
Definition
vacuolar protein sorting 25 homolog (S. cerevisiae)
Orthology
K12189  
ESCRT-II complex subunit VPS25
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Module
ESCRT-II complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84313 (VPS25)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   84313 (VPS25)
  Exosomal proteins of colorectal cancer cells
   84313 (VPS25)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.31
AA seq 176 aa AA seqDB search
MAMSFEWPWQYRFPPFFTLQPNVDTRQKQLAAWCSLVLSFCRLHKQSSMTVMEAQESPLF
NNVKLQRKLPVESIQIVLEELRKKGNLEWLDKSKSSFLIMWRRPEEWGKLIYQWVSRSGQ
NNSVFTLYELTNGEDTEDEEFHGLDEATLLRALQALQQEHKAEIITVSDGRGVKFF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgagtttcgagtggccgtggcagtatcgcttcccacccttctttacgttacaa
ccgaatgtggacactcggcagaagcagctggccgcctggtgctcgctggtcctgtccttc
tgccgcctgcacaaacagtccagcatgacggtgatggaagctcaggagagcccgctcttc
aacaacgtcaagctacagcgaaagcttcctgtggagtcgatccagattgtattagaggaa
ctgaggaagaaagggaacctcgagtggttggataagagcaagtccagcttcctgatcatg
tggcggaggccagaagaatgggggaaactcatctatcagtgggtttccaggagtggccag
aacaactccgtctttaccctgtatgaactgactaatggggaagacacagaggatgaggag
ttccacgggctggatgaagccactctactgcgggctctgcaggccctacagcaggagcac
aaggccgagatcatcactgtcagcgatggccgaggcgtcaagttcttctag

DBGET integrated database retrieval system