KEGG   Homo sapiens (human): 84320Help
Entry
84320             CDS       T01001                                 

Gene name
ACBD6
Definition
(RefSeq) acyl-CoA binding domain containing 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q25.3
AA seq 282 aa AA seqDB search
MASSFLPAGAITGDSGGELSSGDDSGEVEFPHSPEIEETSCLAELFEKAAAHLQGLIQVA
SREQLLYLYARYKQVKVGNCNTPKPSFFDFEGKQKWEAWKALGDSSPSQAMQEYIAVVKK
LDPGWNPQIPEKKGKEANTGFGGPVISSLYHEETIREEDKNIFDYCRENNIDHITKAIKS
KNVDVNVKDEEGRALLHWACDRGHKELVTVLLQHRADINCQDNEGQTALHYASACEFLDI
VELLLQSGADPTLRDQDGCLPEEVTGCKTVSLVLQRHTTGKA
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatcattcctgcccgcgggggccatcaccggcgacagcggtggagagctgagc
tcaggggacgactccggggaggtggagttcccccatagccctgagatcgaggagaccagt
tgcctggccgagctgtttgagaaggctgccgcgcacctgcaaggcctgattcaggtggcc
agcagggagcagctcttgtacctgtatgccaggtacaaacaggtcaaagttggaaattgt
aatactcctaaaccaagcttctttgattttgaaggaaagcaaaaatgggaagcttggaaa
gcacttggtgattcaagccccagccaagcaatgcaggaatatatcgcagtagttaaaaaa
ctagatccaggttggaatcctcagataccagagaagaaaggaaaagaagcaaatacaggt
tttggtgggccagttattagttctctatatcatgaagaaaccatcagggaagaagacaaa
aatatatttgattactgcagggaaaacaacattgaccatataaccaaagccatcaaatcg
aaaaatgtggatgtgaatgtgaaagatgaagagggtagggctctacttcactgggcctgt
gatcgaggacataaggaactagtcacagtgttgctgcaacatagagctgacattaactgt
caggacaatgaaggccaaacagctctacattatgcctctgcctgtgagtttctggatatt
gtagagctgctgctccagtctggtgctgaccccactctccgagaccaggatggctgcctg
ccagaggaggtgacaggctgcaaaacagtttctttggtgctgcagcggcacacaactggc
aaggcttaa

DBGET integrated database retrieval system