KEGG   Homo sapiens (human): 84321Help
Entry
84321             CDS       T01001                                 

Gene name
THOC3, THO3, hTREX45
Definition
(RefSeq) THO complex 3
  KO
K12880  THO complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa03040  Spliceosome
Module
hsa_M00406  TREX complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    84321 (THOC3)
  Translation
   03013 RNA transport
    84321 (THOC3)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     84321 (THOC3)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    84321 (THOC3)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    84321 (THOC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A PD40 Coatomer_WDAD Nup160 Me-amine-dh_H Cytochrom_D1 Peptidase_S9_N WDCP DPPIV_N IKI3
Motif
Other DBs
NCBI-GeneID: 84321
NCBI-ProteinID: NP_115737
OMIM: 606929
HGNC: 19072
Ensembl: ENSG00000051596
Vega: OTTHUMG00000130658
Pharos: Q96J01(Tbio)
UniProt: Q96J01
Position
5q35.2
AA seq 351 aa AA seqDB search
MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHS
VAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASG
DKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQ
FKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFA
TGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDK
LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccccgctgcagccatggggccctcggcgttgggccagagcggccccggctcg
atggccccgtggtgctcagtgagcagcggcccgtcgcgctacgtgcttgggatgcaggag
ctgttccggggccacagcaagacgcgcgagttcctggcgcacagcgccaaggtgcactcg
gtggcctggagttgcgacgggcgtcgcctagcctcggggtccttcgacaagacggccagc
gtcttcttgctggagaaggaccggttggtcaaagaaaacaattatcggggacatggggat
agtgtggaccagctttgttggcatccaagtaatcctgacctatttgttacggcgtccgga
gataaaaccattcgcatctgggatgtgaggactacaaaatgcattgccactgtgaacact
aaaggggagaacattaatatctgctggagtcctgatgggcagaccattgctgtaggcaac
aaggatgatgtggtgacctttattgatgccaagacacaccgttccaaagcagaagagcag
ttcaagttcgaggtcaacgaaatctcctggaacaatgacaataatatgttcttcctgaca
aatggcaatggttgtatcaacatcctcagctacccagaactgaagcctgtgcagtccatc
aacgcccatccttccaactgcatctgtatcaagtttgaccccatggggaagtactttgcc
acaggaagtgcagatgctttggtcagcctctgggatgtggatgagttagtgtgtgttcgg
tgcttttccaggctggattggcctgtaagaaccctcagtttcagccatgatgggaaaatg
ctggcgtcagcatcggaagatcattttattgacattgctgaagtggagacaggggacaaa
ctatgggaggtacagtgtgagtctccgaccttcacagtggcgtggcaccccaaaaggcct
ctgctggcatttgcctgtgatgacaaagacggcaaatatgacagcagccgggaagccgga
actgtgaagctgtttgggcttcctaatgattcttga

DBGET integrated database retrieval system