KEGG   Homo sapiens (human): 84321Help
Entry
84321             CDS       T01001                                 

Gene name
THOC3, THO3, hTREX45
Definition
THO complex 3
Orthology
K12880  
THO complex subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Spliceosome
Module
TREX complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    84321 (THOC3)
  Translation
   03013 RNA transport
    84321 (THOC3)
Spliceosome [BR:hsa03041]
 Complex C
  Other components
   EJC/TREX
    84321 (THOC3)
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   TREX complex
    84321 (THOC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q35.2
AA seq 351 aa AA seqDB search
MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHS
VAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASG
DKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQ
FKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFA
TGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDK
LWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLPNDS
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggcggtccccgctgcagccatggggccctcggcgttgggccagagcggccccggctcg
atggccccgtggtgctcagtgagcagcggcccgtcgcgctacgtgcttgggatgcaggag
ctgttccggggccacagcaagacgcgcgagttcctggcgcacagcgccaaggtgcactcg
gtggcctggagttgcgacgggcgtcgcctagcctcggggtccttcgacaagacggccagc
gtcttcttgctggagaaggaccggttggtcaaagaaaacaattatcggggacatggggat
agtgtggaccagctttgttggcatccaagtaatcctgacctatttgttacggcgtccgga
gataaaaccattcgcatctgggatgtgaggactacaaaatgcattgccactgtgaacact
aaaggggagaacattaatatctgctggagtcctgatgggcagaccattgctgtaggcaac
aaggatgatgtggtgacctttattgatgccaagacacaccgttccaaagcagaagagcag
ttcaagttcgaggtcaacgaaatctcctggaacaatgacaataatatgttcttcctgaca
aatggcaatggttgtatcaacatcctcagctacccagaactgaagcctgtgcagtccatc
aacgcccatccttccaactgcatctgtatcaagtttgaccccatggggaagtactttgcc
acaggaagtgcagatgctttggtcagcctctgggatgtggatgagttagtgtgtgttcgg
tgcttttccaggctggattggcctgtaagaaccctcagtttcagccatgatgggaaaatg
ctggcgtcagcatcggaagatcattttattgacattgctgaagtggagacaggggacaaa
ctatgggaggtacagtgtgagtctccgaccttcacagtggcgtggcaccccaaaaggcct
ctgctggcatttgcctgtgatgacaaagacggcaaatatgacagcagccgggaagccgga
actgtgaagctgtttgggcttcctaatgattcttga

DBGET integrated database retrieval system