KEGG   Homo sapiens (human): 84335Help
Entry
84335             CDS       T01001                                 

Gene name
AKT1S1, Lobe, PRAS40
Definition
AKT1 substrate 1 (proline-rich)
Orthology
K16184  
proline-rich AKT1 substrate 1
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    84335 (AKT1S1)
   04150 mTOR signaling pathway
    84335 (AKT1S1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19q13.33
AA seq 256 aa AA seqDB search
MASGRPEELWEAVVGAAERFRARTGTELVLLTAAPPPPPRPGPCAYAAHGRGALAEAARR
CLHDIALAHRAATAARPPAPPPAPQPPSPTPSPPRPTLAREDNEEDEDEPTETETSGEQL
GISDNGGLFVMDEDATLQDLPPFCESDPESTDDGSLSEETPAGPPTCSVPPASALPTQQY
AKSLPVSVPVWGFKEKRTEARSSDEENGPPSSPDLDRIAASMRALVLREAEDTQVFGDLP
RPRLNTSDFQKLKRKY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcggggcgccccgaggagctgtgggaggccgtggtgggggccgctgagcgcttc
cgggcccggactggcacggagctggtgctgctgaccgcggccccgccgccaccaccccgc
ccgggcccctgtgcctatgctgcccatggtcgaggagccctggcggaggcagcgcgccgt
tgcctccacgacatcgcactggcccacagggctgccactgctgctcggcctcctgcgccc
ccaccagcaccacagccacccagtcccacacccagcccaccccggcctaccctggccaga
gaggacaacgaggaggacgaggatgagcccacagagacagagacctccggggagcagctg
ggcattagtgataatggagggctctttgtgatggatgaggacgccaccctccaggacctt
ccccccttctgtgagtcagaccccgagagtacagatgatggcagcctgagcgaggagacc
cccgccggcccccccacctgctcagtgcccccagcctcagccctacccacacagcagtac
gccaagtccctgcctgtgtctgtgcccgtctggggcttcaaggagaagaggacagaggcg
cggtcatcagatgaggagaatgggccgccctcttcgcccgacctggaccgcatcgcggcg
agcatgcgcgcgctggtgctgcgagaggccgaggacacccaggtcttcggggacctgcca
cggccgcggcttaacaccagcgacttccagaagctgaagcggaaatattga

DBGET integrated database retrieval system