KEGG   Homo sapiens (human): 84364Help
Entry
84364             CDS       T01001                                 

Gene name
ARFGAP2, IRZ, NBLA10535, ZFP289, ZNF289
Definition
ADP-ribosylation factor GTPase activating protein 2
Orthology
K12493  
ADP-ribosylation factor GTPase-activating protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84364 (ARFGAP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p11.2-p11.12
AA seq 493 aa AA seqDB search
MAAEPNKTEIQTLFKRLRAVPTNKACFDCGAKNPSWASITYGVFLCIDCSGVHRSLGVHL
SFIRSTELDSNWNWFQLRCMQVGGNANATAFFRQHGCTANDANTKYNSRAAQMYREKIRQ
LGSAALARHGTDPPAWDAPATEPSGTQQPAPSTESSGLAQPEHGPNTDLLGTSPKASLEL
KSSIIGKKKPAAAKKGLGAKKGLGAQKVSSQSFSEIERQAQVAEKLREQQAADAKKQAEE
SMVASMRLAYQELQIDRKKEEKKLQNLEGKKREQAERLGMGLVSRSSVSHSVLSEMQVIE
QETPVSAKSSRSQLDLFDDVGTFASGPPKYKDNPFSLGESFGSRWDTDAAWGMDRVEEKE
PEVTISSIRPISERATNRREVESRSSGLESSEARQKFAGAKAISSDMFFGREVDAEYEAR
SRLQQLSGSSAISSSDLFGDMDGAHGAGSVSLGNVLPTADIAQFKQGVKSVAGKMAVLAN
GVMNSLQDRYGSY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagccgaacaagaccgaaatccagactctttttaagaggcttcgcgcagtt
ccaaccaacaaggcctgtttcgactgcggcgccaagaatccgagttgggccagcatcacg
tacggtgttttcttgtgcattgactgttccggggtgcaccgctccctgggcgtccatctg
agcttcatcaggtccacagagttggattccaactggaactggttccagctgaggtgtatg
caggtcggcgggaatgccaatgcgacggctttttttcgccaacatggatgcacagccaat
gatgccaacaccaaatataatagccgagctgcccagatgtaccgggagaagatccggcag
ctggggagtgcggccctggctaggcatggcactgatccccctgcctgggatgcgccagcc
actgagccttcagggacccagcagccagccccgtctacagagagcagtggcctggcacag
ccggagcatggccccaacacagacctgcttggcacctcacccaaagcctcactggaactg
aaaagctccatcattggcaagaagaagccagcagcagctaagaaagggctgggtgccaag
aaaggcctaggggcccagaaggtgagcagccagagcttcagtgagattgagcggcaggct
caggtggcagagaagctccgtgagcagcaggcagccgatgccaagaagcaggcggaggag
tccatggtcgcctccatgcgtctggcctaccaggagctccagattgatcgtaagaaagag
gaaaagaagctacagaatctggaagggaagaagcgagagcaggcagaaaggttgggcatg
ggcttggtatcccgaagctctgtctcccactccgtgctgtctgagatgcaggtgattgag
caggaaaccccagtgagtgcaaaatcctctcgctcgcagctggacttgtttgacgatgtt
ggtactttcgcctctggacccccaaagtacaaggacaatcccttttccttaggggaaagc
tttggctcccgctgggatacagatgctgcctggggtatggacagggtagaggagaaggag
ccagaagtgaccatctcaagcatccggcctatttcagaaagagccacaaaccggagggaa
gtggagagccggagctcaggcctcgagtctagtgaggcgcgtcagaaattcgcaggagcc
aaagccatctcatctgacatgttctttgggcgggaggtggatgcggagtatgaggccagg
tctcggctgcagcagctctcaggcagcagtgccatcagctcttcagacctctttggggac
atggatggagctcacggagcaggaagtgtatctctggggaacgtgctgcctacagcggac
attgcccagtttaagcagggtgtcaagtctgtggctgggaaaatggctgtgctggccaat
ggtgtgatgaattccttgcaggatcgctacggttcctactga

DBGET integrated database retrieval system