KEGG   Homo sapiens (human): 84365Help
Entry
84365             CDS       T01001                                 

Gene name
NIFK, MKI67IP, Nopp34
Definition
(RefSeq) nucleolar protein interacting with the FHA domain of MKI67
  KO
K14838  
nucleolar protein 15
Organism
hsa  Homo sapiens (human)
Brite
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   Other pre-60S particles
    84365 (NIFK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q14.3
AA seq 293 aa AA seqDB search
MATFSGPAGPILSLNPQEDVEFQKEVAQVRKRITQRKKQEQLTPGVVYVRHLPNLLDETQ
IFSYFSQFGTVTRFRLSRSKRTGNSKGYAFVEFESEDVAKIVAETMNNYLFGERLLECHF
MPPEKVHKELFKDWNIPFKQPSYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKG
IDYDFPSLILQKTESISKTNRQTSTKGQVLRKKKKKVSGTLDTPEKTVDSQGPTPVCTPT
FLERRKSQVAELNDDDKDDEIVFKQPISCVKEEIQETQTPTHSRKKRRRSSNQ
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atggcgactttttctggcccggctgggccaatcctgtcgcttaatccgcaggaagatgtc
gagtttcaaaaggaggtggcgcaggttcgcaagcgcataacccagcgaaaaaaacaagaa
caacttactcctggagtagtctatgtgcgccacctacctaacctacttgacgaaacccag
atcttttcatatttctcccagtttggcactgtgacacggttcaggctgtccagaagtaaa
aggactggaaatagcaaaggctatgcatttgtggagtttgagtctgaggatgttgccaaa
atagttgctgaaacaatgaacaactacctgtttggtgaaagactcttggagtgtcatttt
atgccacctgaaaaagtacataaagaactctttaaagactggaatattccatttaagcag
ccatcatatccatcagtgaaacggtataatcggaatcggacactaacacaaaagctacgg
atggaggagcgatttaaaaagaaagaaagattactcaggaagaaattagctaaaaaagga
attgactatgattttccttctttgattttacagaaaacggaaagtatttcaaaaactaat
cgtcagacgtctacaaaaggccaggttttacgtaagaagaagaaaaaagtttcaggtact
cttgacactcctgagaagactgtggatagccagggccccacaccagtttgtacaccaaca
tttttggagaggcgaaaatctcaagtggctgaactgaatgatgatgataaagatgatgaa
atagttttcaaacagcccatatcctgtgtaaaagaagaaatacaagagactcaaacacct
acacattcacggaaaaaaagacgaagaagcagcaatcagtga

DBGET integrated database retrieval system