KEGG   Homo sapiens (human): 8438Help
Entry
8438              CDS       T01001                                 

Gene name
RAD54L, HR54, RAD54A, hHR54, hRAD54
Definition
RAD54-like (S. cerevisiae)
Orthology
K10875  
DNA repair and recombination protein RAD54 and RAD54-like protein [EC:3.6.4.-]
Organism
hsa  Homo sapiens (human)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hsa03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32
AA seq 747 aa AA seqDB search
MRRSLAPSQLAKRKPEGRSCDDEDWQPGLVTPRKRKSSSETQIQECFLSPFRKPLSQLTN
QPPCLDSSQHEAFIRSILSKPFKVPIPNYQGPLGSRALGLKRAGVRRALHDPLEKDALVL
YEPPPLSAHDQLKLDKEKLPVHVVVDPILSKVLRPHQREGVKFLWECVTSRRIPGSHGCI
MADEMGLGKTLQCITLMWTLLRQSPECKPEIDKAVVVSPSSLVKNWYNEVGKWLGGRIQP
LAIDGGSKDEIDQKLEGFMNQRGARVSSPILIISYETFRLHVGVLQKGSVGLVICDEGHR
LKNSENQTYQALDSLNTSRRVLISGTPIQNDLLEYFSLVHFVNSGILGTAHEFKKHFELP
ILKGRDAAASEADRQLGEERLRELTSIVNRCLIRRTSDILSKYLPVKIEQVVCCRLTPLQ
TELYKRFLRQAKPAEELLEGKMSVSSLSSITSLKKLCNHPALIYDKCVEEEDGFVGALDL
FPPGYSSKALEPQLSGKMLVLDYILAVTRSRSSDKVVLVSNYTQTLDLFEKLCRARRYLY
VRLDGTMSIKKRAKVVERFNSPSSPDFVFMLSSKAGGCGLNLIGANRLVMFDPDWNPAND
EQAMARVWRDGQKKTCYIYRLLSAGTIEEKIFQRQSHKKALSSCVVDEEQDVERHFSLGE
LKELFILDEASLSDTHDRLHCRRCVNSRQIRPPPDGSDCTSDLAGWNHCTDKWGLRDEVL
QAAWDAASTAITFVFHQRSHEEQRGLR
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaggaggagcttggctcccagccagctggccaagagaaaacctgaaggcaggtcctgt
gatgatgaagactggcaacctggcctagtgactcctaggaaacggaaatccagcagtgag
acccagatccaggagtgtttcctgtctccttttcggaaacctttgagtcagctaaccaat
caaccaccttgtctggacagcagtcagcatgaagcatttattcgaagcattttgtcaaag
cctttcaaagtccccattccaaattatcaaggtcctctgggctctcgagcattgggcctg
aaaagggctggggtccgccgggccctccatgaccccctggaaaaagatgccttggttctg
tatgagcctcccccgctgagcgctcatgaccagctgaagcttgacaaggagaaactccct
gtccatgtggttgttgaccctattctcagtaaggttttgcggcctcatcagagagaggga
gtgaaattcctgtgggagtgtgtcaccagtcggcgcatccctggcagccatggctgcatc
atggctgatgagatgggcctaggaaagacgctgcagtgcatcacattgatgtggacactt
ttacgccagagtccagagtgcaagccagaaattgacaaggcagtggtggtgtcgccttcc
agcctggtgaagaactggtacaatgaggttgggaaatggctcggagggaggatccaacct
ctggccatcgatggaggatctaaggatgaaatagaccaaaagctggaaggattcatgaac
cagcgtggagccagggtgtcttctcccatcctcatcatttcctatgagaccttccgcctt
catgttggagtcctccagaaaggaagtgttggtctggtcatatgtgacgagggacacagg
ctcaagaactctgagaatcagacttaccaagccctggacagcttgaacaccagccggcgg
gtgctcatctccggaactcccatccagaatgatctgcttgagtatttcagcttggtacat
tttgttaattccggcatcctagggactgcccatgaattcaagaagcattttgaattgcca
attttgaagggtcgagacgctgctgctagtgaggcagacaggcagctaggagaggagcgg
ctgcgggagctcaccagcattgtgaatagatgcctgatacggaggacttctgatatcctt
tctaaatatctgcctgtgaagattgagcaggtcgtttgttgtaggctgacaccccttcag
actgagttatacaagaggtttctgagacaagccaaaccggcagaagaattgcttgagggc
aagatgagtgtgtcttccctttcttccatcacctcgctaaagaagctttgtaatcatcca
gctctaatctatgataagtgtgtggaagaggaggatggctttgtgggtgccttggacctc
ttccctcctggttacagctctaaggccctggagccccagctgtcaggtaagatgctggtc
ctggattatattctggcggtgacccgaagccgtagcagtgacaaagtagtgctggtgtcg
aattacacccagactttggatctctttgagaagctgtgccgtgcccgaaggtacttatac
gtccgcctggatggcacgatgtccattaagaagcgagccaaggttgtagaacgcttcaat
agtccatcgagccctgactttgtcttcatgctgagcagcaaagctgggggctgtggcctc
aatctcattggggctaaccggctggtcatgtttgaccctgactggaacccagccaatgat
gaacaagccatggcccgggtctggcgagatggtcaaaagaagacttgctatatctaccgc
ctgctgtctgcagggaccattgaggagaagatcttccagcgtcagagccacaagaaggca
ctgagcagctgtgtggtggatgaggagcaggatgtagagcgccacttctctctgggcgag
ttgaaggagctgtttatcctggatgaagctagcctcagtgacacacatgacaggttgcac
tgccgacgttgtgtcaacagccgtcagatccggccaccccctgatggttctgactgcact
tcagacctggcagggtggaaccactgcactgataagtgggggctccgggatgaggtactc
caggctgcctgggatgctgcctccactgccatcaccttcgtcttccaccagcgttctcat
gaggagcagcggggcctccgctga

DBGET integrated database retrieval system