KEGG   Homo sapiens (human): 8439Help
Entry
8439              CDS       T01001                                 

Gene name
NSMAF, FAN, GRAMD5
Definition
(RefSeq) neutral sphingomyelinase activation associated factor
  KO
K18953  
factor associated with neutral sphingomyelinase activation
Organism
hsa  Homo sapiens (human)
Pathway
Sphingolipid signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    8439 (NSMAF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q12.1
AA seq 917 aa AA seqDB search
MAFIRKKQQEQQLQLYSKERFSLLLLNLEEYYFEQHRANHILHKGSHHERKIRGSLKICS
KSVIFEPDSISQPIIKIPLRDCIKIGKHGENGANRHFTKAKSGGISLIFSQVYFIKEHNV
VAPYKIERGKMEYVFELDVPGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLART
SFDKNRFQNISEKLHMECKAEMVTPLVTNPGHVCITDTNLYFQPLNGYPKPVVQITLQDV
RRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDDLYFYIATYLEHHVAEHTAES
YMLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWIIHDYSSSELDLSNPGTFRDLS
KPVGALNKERLERLLTRYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDN
ADRMFNSIAETWKNCLDGATDFKELIPEFYGDDVSFLVNSLKLDLGKRQGGQMVDDVELP
PWASSPEDFLQKSKDALESNYVSEHLHEWIDLIFGYKQKGSDAVGAHNVFHPLTYEGGVD
LNSIQDPDEKVAMLTQILEFGQTPKQLFVTPHPRRITPKFKSLSQTSSYNASMADSPGEE
SFEDLTEESKTLAWNNITKLQLHEHYKIHKEAVTGITVSRNGSSVFTTSQDSTLKMFSKE
SKMLQRSISFSNMALSSCLLLPGDATVITSSWDNNVYFYSIAFGRRQDTLMGHDDAVSKI
CWHDNRLYSASWDSTVKVWSGVPAEMPGTKRHHFDLLAELEHDVSVDTISLNAASTLLVS
GTKEGTVNIWDLTTATLMHQIPCHSGIVCDTAFSPDSRHVLSTGTDGCLNVIDVQTGMLI
SSMTSDEPQRCFVWDGNSVLSGSQSGELLVWDLLGAKISERIQGHTGAVTCIWMNEQCSS
IITGGEDRQIIFWKLQY
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttatccggaagaagcagcaggagcagcagctgcagctctactccaaggagaga
ttttccttgctgctgcttaacttggaggagtactactttgaacagcatagagccaatcac
attttgcacaagggcagtcaccatgaaaggaaaatcagaggctccttaaaaatatgttca
aaatcggtgatttttgaaccagattcaatatcccagcccatcatcaagattcctttgaga
gactgtataaaaataggaaagcatggagaaaatggagccaatagacacttcacaaaggca
aaatctgggggtatttcactcattttcagtcaggtatatttcattaaagaacataatgtt
gttgcaccatataaaatagaaaggggcaaaatggaatatgtttttgaattggatgttccc
gggaaagtggaagatgttgtggagacgttgcttcagcttcacagagcatcctgccttgac
aaattgggtgaccaaaccgccatgataacagctattttgcagtctcgtttagctagaaca
tcatttgacaaaaacaggttccaaaacatttctgaaaagctgcacatggaatgcaaagca
gaaatggtgacgcctctggtgactaatcctggacacgtgtgcatcacggacacaaacctg
tattttcagcccctcaacggctacccgaaacctgtggtccagataacactccaagatgtc
cgccgcatctacaaaaggaggcacggcctcatgcctctgggcttggaagtattttgcaca
gaagatgatctgtgttccgacatctacctaaagttctatgaacctcaagatagagatgat
ctctatttttacattgccacatacctagagcaccatgtggcggagcacactgctgagagc
tacatgctgcagtggcagcgtggacacctttccaactatcagtacctccttcacctcaac
aacctggccgaccgcagctgcaacgacctctcccagtaccctgtgtttccatggataata
catgattattccagctcagaactagatttgtcaaatccaggaaccttccgggatctcagt
aagccagtaggggccctaaataaggaacggctggagagactactgacacgctaccaggaa
atgcctgaaccaaagttcatgtatgggagtcactactcttccccgggttatgtacttttt
tatcttgttaggattgcaccagagtatatgctgtgcctgcagaatggaagatttgataat
gcagatagaatgttcaacagtattgcagaaacttggaaaaactgtctggatggtgcaacg
gattttaaagagttaattccagaattctatggtgatgatgtgagctttctagtcaatagc
ctgaagttggatttgggaaagagacaaggaggacagatggttgacgacgtggagcttccc
ccttgggcttccagtcccgaggactttctccagaagagcaaagatgcattggaaagcaat
tatgtgtctgaacaccttcacgagtggattgatctaatatttggctacaaacaaaaaggg
agtgatgcagttggggcccataatgtatttcatcccctgacctatgaaggaggtgtagac
ttgaacagcatccaggatcctgatgagaaggtagccatgcttacgcaaatcttggaattt
gggcagacaccaaaacaactatttgtgacaccacatcctcgaaggatcaccccaaagttt
aaaagtttgtcccagacctccagttataatgcttctatggcagattccccaggtgaagag
tcttttgaagacctgaccgaagaaagcaaaacactggcctggaataacatcaccaaactg
cagttacacgagcactataaaatccacaaagaagcagttactggaatcacggtctctcgc
aatggatcttcagtattcacaacatcccaagattccaccttgaagatgttttctaaagaa
tcaaaaatgctacaaagaagtatatcattttcaaatatggctttatcgtcttgtttactt
ttaccaggagatgccactgtcataacttcttcatgggataataatgtctatttttattcc
atagcatttggaagacgccaggacacgttaatgggacatgatgatgctgttagtaagatc
tgttggcatgacaacaggctatattctgcatcgtgggactctacagtgaaggtgtggtct
ggtgttcctgcagagatgccaggcaccaaaagacaccactttgacttgctggccgagctg
gaacatgatgtcagtgtagatacaatcagtttaaatgctgcaagcacactgttagtttcc
ggcaccaaagaaggcacagtgaatatttgggacctcacaacggccaccttaatgcaccag
attccatgccattcagggattgtatgtgacactgcttttagcccagatagtcgccatgtc
ctcagcacaggaacagatggctgtcttaatgtcattgatgtgcagacaggaatgctcatc
tcctccatgacatcagatgagccccagaggtgctttgtctgggatggaaattccgtttta
tctggcagtcagtctggtgaactgctcgtttgggacctccttggagcaaaaatcagtgag
agaatacagggccacacaggtgctgtgacatgtatatggatgaatgaacagtgtagcagt
atcatcacaggaggggaagacagacaaattatattctggaaattgcagtattaa

DBGET integrated database retrieval system