KEGG   Homo sapiens (human): 8440Help
Entry
8440              CDS       T01001                                 

Gene name
NCK2, GRB4, NCKbeta
Definition
NCK adaptor protein 2
Orthology
K07365  
NCK adaptor protein
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
Axon guidance
T cell receptor signaling pathway
Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    8440 (NCK2)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    8440 (NCK2)
  Development
   04360 Axon guidance
    8440 (NCK2)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    8440 (NCK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q12
AA seq 380 aa AA seqDB search
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaagttattgtgatagccaagtgggactacaccgcccagcaggaccaggag
ctggacatcaagaagaacgagcggctgtggttgctggacgactccaagacgtggtggcgg
gtgaggaacgcggccaacaggacgggctatgtaccgtccaactacgtggagcggaagaac
agcctgaagaagggctccctcgtgaagaacctgaaggacacactaggcctcggcaagacg
cgcaggaagaccagcgcgcgggatgcgtcccccacgcccagcacggacgccgagtacccc
gccaatggcagcggcgccgaccgcatctacgacctcaacatcccggccttcgtcaagttc
gcctatgtggccgagcgggaggatgagttgtccctggtgaaggggtcgcgcgtcaccgtc
atggagaagtgcagcgacggttggtggcggggcagctacaacgggcagatcggctggttc
ccctccaactacgtcttggaggaggtggacgaggcggctgcggagtccccaagcttcctg
agcctgcgcaagggcgcctcgctgagcaatggccagggctcccgcgtgctgcatgtggtc
cagacgctgtaccccttcagctcagtcaccgaggaggagctcaacttcgagaagggggag
accatggaggtgattgagaagccggagaacgaccccgagtggtggaaatgcaaaaatgcc
cggggccaggtgggcctcgtccccaaaaactacgtggtggtcctcagtgacgggcctgcc
ctgcaccctgcgcacgccccacagataagctacaccgggccctcgtccagcgggcgcttc
gcgggcagagagtggtactacgggaacgtgacgcggcaccaggccgagtgcgccctcaac
gagcggggcgtggagggcgacttcctcattagggacagcgagtcctcgcccagcgacttc
tccgtgtcccttaaagcgtcagggaagaacaaacacttcaaggtgcagctcgtggacaat
gtctactgcattgggcagcggcgcttccacaccatggacgagctggtggaacactacaaa
aaggcgcccatcttcaccagcgagcacggggagaagctctacctcgtcagggccctgcag
tga

DBGET integrated database retrieval system