KEGG   Homo sapiens (human): 84440Help
Entry
84440             CDS       T01001                                 

Gene name
RAB11FIP4, RAB11-FIP4
Definition
(RefSeq) RAB11 family interacting protein 4 (class II)
  KO
K12485  
Rab11 family-interacting protein 3/4
Organism
hsa  Homo sapiens (human)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84440 (RAB11FIP4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q11.2
AA seq 535 aa AA seqDB search
MRTPPALGSQGSEVTGPTFADGELIPREPGFFPEDEEEAMTLAPPEGPQELYTDSPMEST
QSLEGSVGSPAEKDGGLGGLFLPEDKSLVHTPSMTTSDLSTHSTTSLISNEEQFEDYGEG
DDVDCAPSSPCPDDETRTNVYSDLGSSVSSSAGQTPRKMRHVYNSELLDVYCSQCCKKIN
LLNDLEARLKNLKANSPNRKISSTAFGRQLMHSSNFSSSNGSTEDLFRDSIDSCDNDITE
KVSFLEKKVTELENDSLTNGDLKSKLKQENTQLVHRVHELEEMVKDQETTAEQALEEEAR
RHREAYGKLEREKATEVELLNARVQQLEEENTELRTTVTRLKSQTEKLDEERQRMSDRLE
DTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRKELEHLQMYKLDCERPGR
GRSASSGLGEFNARAREVELEHEVKRLKQENYKLRDQNDDLNGQILSLSLYEAKNLFAAQ
TKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaccccgccagctctcgggagccagggcagcgaggtcacaggccccacctttgct
gatggcgagctcatccccagggaacccggcttttttcccgaggacgaggaggaggctatg
acgctggcgccacctgagggcccccaggagttgtacacagacagccccatggagagcact
cagagcctggaggggtctgtcgggagtcctgccgagaaggacgggggacttgggggcctg
tttctgccagaagacaagtccctggtccacactccatccatgacgacctcagacctttct
acacactccaccacctcgctcatcagcaatgaggagcagtttgaagactatggggagggt
gacgatgtggactgtgcccccagcagcccttgccccgatgatgagaccaggaccaacgtc
tactcggacctggggtcttcggtgtcttccagtgcggggcagacgcctaggaaaatgcgg
cacgtgtacaacagcgaattgctagatgtttactgctctcaatgctgcaagaaaatcaac
ctgctcaatgacttggaagcccgactgaaaaacctgaaggccaacagccccaaccgaaag
atctccagcacggcctttggacggcagctcatgcacagcagcaacttcagcagcagcaat
ggcagcaccgaagacctgttccgggacagcattgactcttgcgacaatgacatcacagag
aaggtaagcttcctggaaaagaaggtgacagagctggagaatgacagcctgaccaatggg
gacctgaagagcaagctgaagcaagagaacacacagctggtgcacagggtgcatgagctg
gaggagatggtgaaggatcaggagaccacggccgagcaggctctggaggaggaggcgcgg
cgccaccgcgaggcctacggcaagctggagagggagaaggctaccgaggtggagctgctc
aatgccagggtgcagcagttggaggaagaaaatacagagcttagaacaacagtgactcgg
ctcaagtctcaaacagagaaactggatgaggagcggcagcgcatgtctgaccgtctggag
gacaccagcctgcggctcaaagatgagatggacctgtacaagcgcatgatggacaagctg
cgacagaaccgccttgagttccagaaggagcgggaggcgacgcaggagctcatcgaggac
ttgcggaaggagctggagcacctgcagatgtacaagctggactgcgagcggccaggcagg
ggccgcagtgcctcctctggcctaggcgagttcaatgccagggcccgcgaggtggagctc
gagcacgaggtcaagcggctcaagcaggagaattataagctgcgggatcagaacgacgac
ttgaatgggcagattttgagcctcagcctctacgaagcaaaaaacctctttgctgcccag
actaaagcccagtctctggctgcggagatagacaccgcctcgcgcgatgagctaatggaa
gccctgaaggagcaggaggagatcaacttccggctgaggcagtacatggacaagattatc
ctcgccatcctggaccacaatccctccatcctcgagatcaaacactaa

DBGET integrated database retrieval system