KEGG   Homo sapiens (human): 84501Help
Entry
84501             CDS       T01001                                 

Gene name
SPIRE2, Spir-2
Definition
spire-type actin nucleation factor 2
Orthology
K02098  
spire
Organism
hsa  Homo sapiens (human)
Pathway
Dorso-ventral axis formation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    84501 (SPIRE2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24
AA seq 714 aa AA seqDB search
MARAGSCGGAAAGAGRPEPWELSLEEVLKAYEQPLNEEQAWAVCFQGCRGLRGSPGRRLR
DTGDLLLRGDGSVGAREPEAAEPATMVVPLASSEAQTVQSLGFAIYRALDWGLDESEERE
LSPQLERLIDLMANNDSEDSGCGAADEGYGGPEEEEEAEGVPRSVRTFAQAMRLCAARLT
DPRGAQAHYQAVCRALFVETLELRAFLARVREAKEMLQKLREDEPHLETPRAELDSLGHT
DWARLWVQLMRELRRGVKLKKVQEQEFNPLPTEFQLTPFEMLMQDIRARNYKLRKVMVDG
DIPPRVKKDAHELILDFIRSRPPLKQVSERRLRPLPPKQRSLHEKILEEIKQERRLRPVR
GEGWAARGFGSLPCILNACSGDAKSTSCINLSVTDAGGSAQRPRPRVLLKAPTLAEMEEM
NTSEEEESPCGEVTLKRDRSFSEHDLAQLRSEVASGLQSATHPPGGTEPPRPRAGSAHVW
RPGSRDQGTCPASVSDPSHPLLSNRGSSGDRPEASMTPDAKHLWLEFSHPVESLALTVEE
VMDVRRVLVKAEMEKFLQNKELFSSLKKGKICCCCRAKFPLFSWPPSCLFCKRAVCTSCS
IKMKMPSKKFGHIPVYTLGFESPQRVSAAKTAPIQRRDIFQSLQGPQWQSVEEAFPHIYS
HGCVLKDVCSECTSFVADVVRSSRKSVDVLNTTPRRSRQTQSLYIPNTRTLDFK
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcccgggcgggcagctgcggcggcgccgcggcgggcgcagggcggccggagccctgg
gagctgtccctggaggaggtgctgaaggcctacgagcagccgctcaacgaggagcaggcg
tgggccgtgtgcttccagggctgccgcgggctgcggggctcgccgggccggcgcctgcgg
gataccggggacctcctgctgcgcggggacggctcggtcggggcgcgggagcccgaggcc
gcggaacctgcaaccatggtcgtgccactagccagctcggaagcccagaccgtgcagtcc
ctcggcttcgccatctaccgcgcgctggactgggggctggacgagagcgaggagcgcgaa
ctcagccctcagctggagcggctcatcgacctcatggccaacaacgacagcgaggacagc
ggctgcggtgccgccgatgagggctacgggggtcccgaggaggaggaggaggccgagggc
gtcccccgcagcgtgcgcacctttgcccaggccatgcggctgtgcgcggcgcggctgacc
gacccccggggcgcacaggcgcattaccaggccgtgtgccgcgcgctcttcgtggagacg
ctggagctgcgggccttcctggccagggtccgggaggccaaggagatgctgcagaagctt
cgggaggacgagccgcatctggagacgcctcgggcagagctggacagcctgggtcacaca
gactgggcccgactgtgggttcagctcatgcgggagctccgccgcggagtgaagctgaag
aaggtgcaagagcaggagttcaaccccctccccaccgagttccagctcacgcccttcgag
atgctgatgcaggacatccgggcccggaactacaagctgcgcaaggtcatggtggatggg
gacatcccgccccgggtgaagaaggacgctcacgagctcatcctggactttatccgctca
cggcctccactgaagcaggtctctgagaggcggctgcgcccgttgccaccaaagcaaagg
tccctgcatgagaagatcctggaggagatcaagcaggagcggaggctgcgcccggtgcgg
ggcgagggctgggctgcccgcgggtttggctctctgccctgcatcctcaacgcctgctcc
ggagatgccaagtccacctcctgcatcaacctgtcagtcacagatgctgggggcagcgcc
cagcgcccgcggccccgcgtgctgctcaaggcgcctaccttggctgaaatggaagagatg
aatacatctgaggaagaagagtctccgtgtggggaggtgacgctgaaacgggaccgctcc
ttctcagagcatgacctggcccagctccgaagtgaggtggcctctggcctgcagtcggcc
acccaccccccaggagggacggagccaccacggccccgagctggcagtgcgcatgtgtgg
aggcccggctcccgagaccagggtacctgtcccgcgagtgtctctgaccccagccacccc
ctactcagcaaccggggctcctcgggggacagacccgaggcctccatgacccccgatgcc
aaacacctgtggctggagttcagccaccccgtggagagcctggcgctgactgtggaagag
gtgatggacgtgcgccgtgtgctggtgaaggccgagatggaaaagtttttgcagaacaag
gagctcttcagcagtctgaagaaggggaagatttgctgctgctgccgggccaagttcccg
ctgttctcgtggccgcccagctgtctcttctgcaagagagccgtctgcacttcctgtagc
ataaagatgaagatgccttctaagaaatttggacacatccctgtctacacactgggcttt
gagagtcctcagagggtatcagctgccaaaaccgcgccaatccagagaagagacatcttt
cagtctctgcaagggccacagtggcagagcgtggaggaggcgttcccccacatctactcc
cacggctgtgtcctgaaggatgtctgcagtgagtgcaccagctttgtggcagacgtggtg
cgttccagccgcaagagcgtggacgtcctcaacactacgccacgacgcagtcgccagacc
caatccctctacatccctaacaccaggactcttgacttcaagtga

DBGET integrated database retrieval system