KEGG   Homo sapiens (human): 84516Help
Entry
84516             CDS       T01001                                 

Gene name
DCTN5
Definition
(RefSeq) dynactin subunit 5
  KO
K10427  
dynactin 5
Organism
hsa  Homo sapiens (human)
Pathway
Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    84516 (DCTN5)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules
    Dynactin complex
     84516 (DCTN5)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dynactins
     84516 (DCTN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p12.2
AA seq 182 aa AA seqDB search
MELGELLYNKSEYIETASGNKVSRQSVLCGSQNIVLNGKTIVMNDCIIRGDLANVRVGRH
CVVKSRSVIRPPFKKFSKGVAFFPLHIGDHVFIEEDCVVNAAQIGSYVHVGKNCVIGRRC
VLKDCCKILDNTVLPPETVVPPFTVFSGCPGLFSGELPECTQELMIDVTKSYYQKFLPLT
QV
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggagttgggcgagctgctctacaacaagtctgagtacatcgagacggcatctgggaac
aaagtcagtcgccagtcagtgttgtgtggaagccagaacatcgttctcaatggcaagacc
attgtgatgaatgactgtattatccgaggggatctggcaaatgtaagagttggacgtcat
tgtgttgtgaaaagtcgtagtgtcataaggccaccattcaagaagttcagcaaaggtgtt
gcattctttcctttacatattggagaccatgtctttattgaggaagattgtgtggtcaac
gcagcacagattggttcctatgttcatgttgggaagaactgtgtgattgggcgccgatgt
gtgttgaaagactgctgcaaaattcttgacaacacagtattacctccagaaactgtggtt
ccaccattcactgtcttctcaggctgcccaggactcttctcaggggagctcccggagtgc
actcaggagctgatgattgacgtcaccaagagctactaccagaagtttttgcccctgacg
caagtctag

DBGET integrated database retrieval system