KEGG   Homo sapiens (human): 8452Help
Entry
8452              CDS       T01001                                 

Gene name
CUL3, CUL-3, PHA2E
Definition
cullin 3
Orthology
K03869  
cullin 3
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Module
Cul3-SPOP complex
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q36.2
AA seq 702 aa AA seqDB search
MSNLSKGTGSRKDTKMRIRAFPVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIRDILMYM
DRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDRGAIRNA
CQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEARINEEIE
RVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMYKLFSRV
PNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESFNNDRLF
KQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFRFMQEKD
VFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSISNTTMDE
FRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYLAKHSGR
QLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMTILMLFN
NREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFTVNDQFT
SKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEV
TQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctgagcaaaggcacgggcagccggaaggacaccaagatgcggatccgggcc
tttccggtgcgagaagatgtactaaattcattgaataacaactttcttcaaacgctaaat
caagcttggaatgatcatcaaacagctatggtgatgattagagacatactaatgtacatg
gaccgtgtgtatgtacaacaaaataatgtggagaacgtctacaatttgggattaattatt
tttcgagatcaagttgtacgttatgggtgtattagggatcatctacggcaaactctattg
gatatgattgcaagagagcggaaaggagaagtcgtagacagaggcgcaataagaaatgct
tgccagatgttaatgattttaggtctcgaaggaagatcagtctatgaagaagattttgag
gctccttttttggaaatgtctgcagaattttttcagatggaaagccagaaatttttagca
gaaaatagtgcttcagtatatataaagaaagtagaagctagaattaatgaagaaatagaa
cgagtgatgcactgccttgacaaatcaacggaagaaccaattgtaaaggtggttgaaagg
gaactcatttccaagcacatgaagactatagtagaaatggagaattctgggctagtacat
atgttgaaaaatggaaagacagaagaccttggttgcatgtacaagttatttagtcgtgtg
ccaaatggtttgaaaacaatgtgtgagtgtatgagttcctatttgagggagcaaggtaaa
gctcttgtttctgaagaaggagaaggaaagaatcctgttgactatatccagggcttattg
gatctgaagagtaggttcgatcgcttcctcctggaatcattcaacaatgaccgtctcttt
aaacaaactattgcgggtgactttgagtattttctcaacctcaactccaggtctcctgaa
tacctctcattatttattgatgataagctgaaaaagggagtcaaagggctaacagaacaa
gaagtagaaacaatattggataaagcaatggtcctttttaggtttatgcaagaaaaagat
gtatttgaacgttattataaacaacacttggcaaggagacttctcacaaataaaagtgtt
tctgatgactctgaaaaaaacatgatatctaagttaaagactgaatgtggatgtcagttc
acgtcaaaactggaaggaatgtttagggatatgagcatctcaaacacaacgatggatgaa
ttcaggcaacatctacaggcaactggtgtatctttaggtggtgttgatcttacagtccgg
gtgctcacgacaggatattggcccactcagtcagccacaccaaagtgcaacatcccacca
gcaccaagacatgcttttgagatattcagaaggttctacttagccaaacacagtggtcga
cagctcacactccagcatcatatgggttctgcagatctcaatgccacattttatggacca
gttaaaaaggaagatggatctgaagttggtgttggaggtgcacaagtaactggctctaat
acacggaagcacatattgcaagtttccactttccagatgaccatattaatgctctttaat
aatagagaaaaatacacatttgaggaaattcagcaagagacagatatccctgaaagagag
cttgttagagccctacagtccctcgcctgtggtaaaccaacacagcgggttcttacaaaa
gaacccaaatcaaaggaaatagaaaatggtcatatatttacagttaatgatcaattcaca
tccaaactacacagagtcaagattcaaacagttgctgccaaacaaggtgaatccgaccca
gagaggaaagaaacaaggcagaaagtagacgacgacagaaaacatgagatagaagctgct
atagtgcggataatgaaatctagaaagaagatgcagcacaatgttctagtagcggaggta
actcagcagttgaaggcgcgattcttaccaagtccagttgttattaagaaacgtattgaa
ggacttattgagagagaatatttggcacgaacacctgaggatcgcaaagtatacacatat
gtagcataa

DBGET integrated database retrieval system