KEGG   Homo sapiens (human): 8452Help
Entry
8452              CDS       T01001                                 

Gene name
CUL3, CUL-3, PHA2E
Definition
(RefSeq) cullin 3
  KO
K03869  
cullin 3
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Hedgehog signaling pathway
Module
Cul3-SPOP complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8452 (CUL3)
 Environmental Information Processing
  Signal transduction
   04340 Hedgehog signaling pathway
    8452 (CUL3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Cullin
     8452 (CUL3)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     8452 (CUL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q13618(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2q36.2
AA seq 768 aa AA seqDB search
MSNLSKGTGSRKDTKMRIRAFPMTMDEKYVNSIWDLLKNAIQEIQRKNNSGLSFEELYRN
AYTMVLHKHGEKLYTGLREVVTEHLINKVREDVLNSLNNNFLQTLNQAWNDHQTAMVMIR
DILMYMDRVYVQQNNVENVYNLGLIIFRDQVVRYGCIRDHLRQTLLDMIARERKGEVVDR
GAIRNACQMLMILGLEGRSVYEEDFEAPFLEMSAEFFQMESQKFLAENSASVYIKKVEAR
INEEIERVMHCLDKSTEEPIVKVVERELISKHMKTIVEMENSGLVHMLKNGKTEDLGCMY
KLFSRVPNGLKTMCECMSSYLREQGKALVSEEGEGKNPVDYIQGLLDLKSRFDRFLLESF
NNDRLFKQTIAGDFEYFLNLNSRSPEYLSLFIDDKLKKGVKGLTEQEVETILDKAMVLFR
FMQEKDVFERYYKQHLARRLLTNKSVSDDSEKNMISKLKTECGCQFTSKLEGMFRDMSIS
NTTMDEFRQHLQATGVSLGGVDLTVRVLTTGYWPTQSATPKCNIPPAPRHAFEIFRRFYL
AKHSGRQLTLQHHMGSADLNATFYGPVKKEDGSEVGVGGAQVTGSNTRKHILQVSTFQMT
ILMLFNNREKYTFEEIQQETDIPERELVRALQSLACGKPTQRVLTKEPKSKEIENGHIFT
VNDQFTSKLHRVKIQTVAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHN
VLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatctgagcaaaggcacgggcagccggaaggacaccaagatgcggatccgggcc
tttccgatgaccatggatgaaaaatatgtaaacagcatttgggaccttctgaaaaatgca
attcaagaaatccagcgtaagaataacagtggtcttagttttgaggagctctatagaaat
gcatatacaatggttttgcataaacatggagaaaagctctacactggactaagagaagtt
gttaccgaacatctcataaataaggtgcgagaagatgtactaaattcattgaataacaac
tttcttcaaacgctaaatcaagcttggaatgatcatcaaacagctatggtgatgattaga
gacatactaatgtacatggaccgtgtgtatgtacaacaaaataatgtggagaacgtctac
aatttgggattaattatttttcgagatcaagttgtacgttatgggtgtattagggatcat
ctacggcaaactctattggatatgattgcaagagagcggaaaggagaagtcgtagacaga
ggcgcaataagaaatgcttgccagatgttaatgattttaggtctcgaaggaagatcagtc
tatgaagaagattttgaggctccttttttggaaatgtctgcagaattttttcagatggaa
agccagaaatttttagcagaaaatagtgcttcagtatatataaagaaagtagaagctaga
attaatgaagaaatagaacgagtgatgcactgccttgacaaatcaacggaagaaccaatt
gtaaaggtggttgaaagggaactcatttccaagcacatgaagactatagtagaaatggag
aattctgggctagtacatatgttgaaaaatggaaagacagaagaccttggttgcatgtac
aagttatttagtcgtgtgccaaatggtttgaaaacaatgtgtgagtgtatgagttcctat
ttgagggagcaaggtaaagctcttgtttctgaagaaggagaaggaaagaatcctgttgac
tatatccagggcttattggatctgaagagtaggttcgatcgcttcctcctggaatcattc
aacaatgaccgtctctttaaacaaactattgcgggtgactttgagtattttctcaacctc
aactccaggtctcctgaatacctctcattatttattgatgataagctgaaaaagggagtc
aaagggctaacagaacaagaagtagaaacaatattggataaagcaatggtcctttttagg
tttatgcaagaaaaagatgtatttgaacgttattataaacaacacttggcaaggagactt
ctcacaaataaaagtgtttctgatgactctgaaaaaaacatgatatctaagttaaagact
gaatgtggatgtcagttcacgtcaaaactggaaggaatgtttagggatatgagcatctca
aacacaacgatggatgaattcaggcaacatctacaggcaactggtgtatctttaggtggt
gttgatcttacagtccgggtgctcacgacaggatattggcccactcagtcagccacacca
aagtgcaacatcccaccagcaccaagacatgcttttgagatattcagaaggttctactta
gccaaacacagtggtcgacagctcacactccagcatcatatgggttctgcagatctcaat
gccacattttatggaccagttaaaaaggaagatggatctgaagttggtgttggaggtgca
caagtaactggctctaatacacggaagcacatattgcaagtttccactttccagatgacc
atattaatgctctttaataatagagaaaaatacacatttgaggaaattcagcaagagaca
gatatccctgaaagagagcttgttagagccctacagtccctcgcctgtggtaaaccaaca
cagcgggttcttacaaaagaacccaaatcaaaggaaatagaaaatggtcatatatttaca
gttaatgatcaattcacatccaaactacacagagtcaagattcaaacagttgctgccaaa
caaggtgaatccgacccagagaggaaagaaacaaggcagaaagtagacgacgacagaaaa
catgagatagaagctgctatagtgcggataatgaaatctagaaagaagatgcagcacaat
gttctagtagcggaggtaactcagcagttgaaggcgcgattcttaccaagtccagttgtt
attaagaaacgtattgaaggacttattgagagagaatatttggcacgaacacctgaggat
cgcaaagtatacacatatgtagcataa

DBGET integrated database retrieval system