KEGG   Homo sapiens (human): 8453Help
Entry
8453              CDS       T01001                                 

Gene name
CUL2
Definition
cullin 2
Orthology
K03870  
cullin 2
Organism
hsa  Homo sapiens (human)
Pathway
HIF-1 signaling pathway
Ubiquitin mediated proteolysis
Pathways in cancer
Renal cell carcinoma
Module
ECV complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8453 (CUL2)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    8453 (CUL2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    8453 (CUL2)
   05211 Renal cell carcinoma
    8453 (CUL2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   ECV complex
    Cullin
     8453 (CUL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p11.21
AA seq 745 aa AA seqDB search
MSLKPRVVDFDETWNKLLTTIKAVVMLEYVERATWNDRFSDIYALCVAYPEPLGERLYTE
TKIFLENHVRHLHKRVLESEEQVLVMYHRYWEEYSKGADYMDCLYRYLNTQFIKKNKLTE
ADLQYGYGGVDMNEPLMEIGELALDMWRKLMVEPLQAILIRMLLREIKNDRGGEDPNQKV
IHGVINSFVHVEQYKKKFPLKFYQEIFESPFLTETGEYYKQEASNLLQESNCSQYMEKVL
GRLKDEEIRCRKYLHPSSYTKVIHECQQRMVADHLQFLHAECHNIIRQEKKNDMANMYVL
LRAVSTGLPHMIQELQNHIHDEGLRATSNLTQENMPTLFVESVLEVHGKFVQLINTVLNG
DQHFMSALDKALTSVVNYREPKSVCKAPELLAKYCDNLLKKSAKGMTENEVEDRLTSFIT
VFKYIDDKDVFQKFYARMLAKRLIHGLSMSMDSEEAMINKLKQACGYEFTSKLHRMYTDM
SVSADLNNKFNNFIKNQDTVIDLGISFQIYVLQAGAWPLTQAPSSTFAIPQELEKSVQMF
ELFYSQHFSGRKLTWLHYLCTGEVKMNYLGKPYVAMVTTYQMAVLLAFNNSETVSYKELQ
DSTQMNEKELTKTIKSLLDVKMINHDSEKEDIDAESSFSLNMNFSSKRTKFKITTSMQKD
TPQEMEQTRSAVDEDRKMYLQAAIVRIMKARKVLRHNALIQEVISQSRARFNPSISMIKK
CIEVLIDKQYIERSQASADEYSYVA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgtctttgaaaccaagagtagtagattttgatgaaacatggaacaaacttttgacgaca
ataaaagccgtggtcatgttggaatacgtcgaaagagcaacatggaatgaccgtttctca
gatatctatgctttatgtgtggcctatcctgaaccccttggagaaagactttatacagaa
actaagatttttttggaaaatcatgttcggcatttgcataagagagttttggagtcagaa
gaacaagtacttgttatgtatcataggtactgggaagaatacagcaagggtgcagactat
atggactgcttatataggtatctcaacacccagtttattaaaaagaataaattaacagaa
gcggaccttcagtatggctatggtggtgtagatatgaatgaaccacttatggaaatagga
gagctagcattggatatgtggaggaaattgatggttgaaccacttcaggccatccttatc
cgaatgctgctccgagaaatcaaaaatgatcgtggtggagaagacccaaaccagaaagta
atccatggggttattaactcctttgttcatgttgaacagtataagaaaaaattcccctta
aagttttatcaggaaatttttgagtctccctttctgactgaaacaggagagtattacaaa
caagaagcttcaaatttattacaagaatcaaactgctcacagtatatggaaaaggttcta
ggtagattaaaagatgaagaaattcgatgtcgaaaatacctacatccaagttcatatact
aaggtgattcatgaatgtcaacaacgaatggtagcagaccacttacagtttttacatgca
gaatgtcataatataattcgacaagagaaaaaaaatgacatggcaaatatgtacgtctta
ctccgtgctgtgtccactggtttacctcatatgattcaggagctgcaaaaccacatccat
gatgagggccttcgagcaaccagcaaccttactcaggaaaacatgccaacactatttgtg
gagtcagttttggaagtgcatggtaaatttgttcagcttatcaacactgttttgaatggt
gatcagcattttatgagtgcgttggataaggcccttacgtcagttgtaaattacagagaa
cctaagtctgtttgcaaagcacctgaactgcttgctaagtactgtgacaacttactgaag
aagtcagcgaaagggatgacagagaatgaagtggaagacaggctcacgagcttcatcaca
gtgttcaaatacattgatgacaaggacgtctttcaaaagttctacgcaagaatgctggca
aaacgtttaattcatgggttatccatgtctatggactctgaagaagccatgatcaacaaa
ttaaagcaagcctgtggttatgagtttaccagcaagctacatcggatgtatacagatatg
agtgtcagcgctgatctcaacaataagttcaacaattttatcaaaaaccaagacacagta
atagatttgggaattagttttcaaatatatgttctacaggctggtgcgtggcctcttact
caggctccttcatctacgtttgcaattccccaggaattagaaaaaagtgtacagatgttt
gaattattttatagccaacatttcagtggaaggaaacttacatggttacattatctgtgt
acaggtgaagttaaaatgaactatttgggcaaaccatatgtagccatggttacaacatac
caaatggcagttcttcttgcctttaacaacagtgaaactgtcagttataaagagcttcag
gacagcactcagatgaatgaaaaggaactgacaaaaacaatcaaatcattacttgatgtg
aaaatgattaaccatgattcagaaaaggaagatattgatgcagaatcttcgttttcatta
aatatgaactttagcagtaaaagaacaaaatttaaaattactacatcaatgcagaaagac
acaccacaagaaatggagcagactagaagtgcagttgatgaggaccggaaaatgtatctc
caagctgctatagttcgtatcatgaaagcacgaaaagtgcttcggcacaatgcccttatt
caagaggtgattagccagtcaagagctaggtttaatcccagtatcagcatgattaagaag
tgtattgaagttctgatagacaaacaatacatagaacgcagccaggcgtcggcagatgaa
tacagctacgtcgcgtga

DBGET integrated database retrieval system