KEGG   Homo sapiens (human): 84539Help
Entry
84539             CDS       T01001                                 

Gene name
MCHR2, GPR145, GPRv17, MCH-2R, MCH-R2, MCH2, MCH2R, MCHR-2, SLT
Definition
melanin-concentrating hormone receptor 2
Orthology
K05054  
melanin-concentrating hormone receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    84539 (MCHR2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Melanin-concentrating hormone
    84539 (MCHR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
UniProt: 
Position
6q16
AA seq 340 aa AA seqDB search
MNPFHASCWNTSAELLNKSWNKEFAYQTASVVDTVILPSMIGIICSTGLVGNILIVFTII
RSRKKTVPDIYICNLAVADLVHIVGMPFLIHQWARGGEWVFGGPLCTIITSLDTCNQFAC
SAIMTVMSVDRYFALVQPFRLTRWRTRYKTIRINLGLWAASFILALPVWVYSKVIKFKDG
VESCAFDLTSPDDVLWYTLYLTITTFFFPLPLILVCYILILCYTWEMYQQNKDARCCNPS
VPKQRVMKLTKMVLVLVVVFILSAAPYHVIQLVNLQMEQPTLAFYVGYYLSICLSYASSS
INPFLYILLSGNFQKRLPQIQRRATEKEINNMGNTLKSHF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaatccatttcatgcatcttgttggaacacctctgccgaacttttaaacaaatcctgg
aataaagagtttgcttatcaaactgccagtgtggtagatacagtcatcctcccttccatg
attgggattatctgttcaacagggctggttggcaacatcctcattgtattcactataata
agatccaggaaaaaaacagtccctgacatctatatctgcaacctggctgtggctgatttg
gtccacatagttggaatgccttttcttattcaccaatgggcccgagggggagagtgggtg
tttggggggcctctctgcaccatcatcacatccctggatacttgtaaccaatttgcctgt
agtgccatcatgactgtaatgagtgtggacaggtactttgccctcgtccaaccatttcga
ctgacacgttggagaacaaggtacaagaccatccggatcaatttgggcctttgggcagct
tcctttatcctggcattgcctgtctgggtctactcgaaggtcatcaaatttaaagacggt
gttgagagttgtgcttttgatttgacatcccctgacgatgtactctggtatacactttat
ttgacgataacaactttttttttccctctacccttgattttggtgtgctatattttaatt
ttatgctatacttgggagatgtatcaacagaataaggatgccagatgctgcaatcccagt
gtaccaaaacagagagtgatgaagttgacaaagatggtgctggtgctggtggtagtcttt
atcctgagtgctgccccttatcatgtgatacaactggtgaacttacagatggaacagccc
acactggccttctatgtgggttattacctctccatctgtctcagctatgccagcagcagc
attaacccttttctctacatcctgctgagtggaaatttccagaaacgtctgcctcaaatc
caaagaagagcgactgagaaggaaatcaacaatatgggaaacactctgaaatcacacttt
tag

DBGET integrated database retrieval system