KEGG   Homo sapiens (human): 84552Help
Entry
84552             CDS       T01001                                 

Gene name
PARD6G, PAR-6G, PAR6gamma
Definition
(RefSeq) par-6 family cell polarity regulator gamma
  KO
K06093  
partitioning defective protein 6
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Endocytosis
Axon guidance
Hippo signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    84552 (PARD6G)
   04390 Hippo signaling pathway
    84552 (PARD6G)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84552 (PARD6G)
  Cellular community - eukaryotes
   04530 Tight junction
    84552 (PARD6G)
 Organismal Systems
  Development
   04360 Axon guidance
    84552 (PARD6G)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     84552 (PARD6G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q9BYG4(Tdark)
UniProt: 
Position
18q23
AA seq 376 aa AA seqDB search
MNRSFHKSQTLRFYDCSAVEVKSKFGAEFRRFSLDRHKPGKFEDFYKLVVHTHHISNSDV
TIGYADVHGDLLPINNDDNFCKAVSSANPLLRVFIQKREEAERGSLGAGSLCRRRRALGA
LRDEGPRRRAHLDIGLPRDFRPVSSIIDVDLVPETHRRVRLHRHGCEKPLGFYIRDGASV
RVTPHGLEKVPGIFISRMVPGGLAESTGLLAVNDEVLEVNGIEVAGKTLDQVTDMMIANS
HNLIVTVKPANQRNNVVRGGRALGSSGPPSDGTAGFVGPPAPRVLQNFHPDEAESDEDND
VVIEGTLEPARPPQTPGAPAGSLSRVNGAGLAQRLQRDLALDGGLQRLLSSLRADPRHSL
ALPPGGVEEHGPAVTL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaagttttcacaagtctcagaccttgcgattctacgattgcagcgcagtggaa
gtcaagagcaagtttggggcggaattccgaaggttctctctggaccgtcataagcctggg
aagtttgaagatttctacaagctggttgtgcacacccaccatatctccaacagtgatgta
actattggctatgcagatgtgcacggagacctgctgcccatcaacaatgatgacaacttc
tgcaaggcggtttctagtgcaaatcccctgctcagggtcttcatccagaaacgagaggag
gccgagcgtggcagcctcggcgcgggctcgctgtgcaggcggaggcgggcgctgggcgcg
ctgcgtgatgaaggaccccggcggcgtgcacacctggacatcggcctcccgcgcgacttc
cgccccgtatcatccatcatcgatgtggacctggtccccgagacgcaccggcgagtgcgg
ctgcaccggcacggctgcgagaagccgctgggcttctacatccgcgatggcgccagcgtg
cgcgtgaccccgcacgggctggagaaggtgcccggcatcttcatctcgcgcatggtaccc
gggggcctggcggagagcaccgggctgctggctgtgaatgacgaggtcctggaggtgaac
ggcattgaggtggccgggaagacgctggaccaggtcacggacatgatgatcgccaacagc
cacaacctcatcgtcaccgtcaagcccgccaaccagcgcaacaacgtggtgcgcggcggc
cgcgcgttgggcagctcgggaccgccctcggacggcaccgcgggcttcgtgggtcccccc
gccccgcgcgtcctgcagaacttccaccccgacgaggcggagagcgatgaggacaacgac
gtcgtcatcgagggcacactggagcctgcacgtcccccccagaccccgggcgcgcccgca
ggcagcctctcccgggtcaatggcgcgggcctggcgcagcggctgcagcgggacctggcc
ctggacggcggcctccagcggctgctcagctccctgcgggccgacccccgtcacagcctg
gcgctgccgccaggcggcgtggaggagcacgggcccgcggtcacgctctag

DBGET integrated database retrieval system