KEGG   Homo sapiens (human): 84569Help
Entry
84569             CDS       T01001                                 

Gene name
LYZL1, KAAG648, LYC2, PRO1278, bA534G20.1
Definition
lysozyme-like 1 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     84569 (LYZL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p12.1
AA seq 194 aa AA seqDB search
MQDAPLSCLSPTKWSSVSSADSTEKSASGAGTRNLPFQFCLRQALRMKAAGILTLIGCLV
TGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALITDDLTDAIICARKIVKETQGMNYWQGWKKHCE
GRDLSEWKKGCEVS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgctcccctgagctgcctgtcaccgactaagtggagcagtgtttcttccgca
gactcaactgagaagtcagcctctggggcaggcaccaggaatctgccttttcagttctgt
ctccggcaggctttgaggatgaaggctgcgggcattctgaccctcattggctgcctggtc
acaggcgccgagtccaaaatctacactcgttgcaaactggcaaaaatattctcgagggct
ggcctggacaattactggggcttcagccttggaaactggatctgcatggcatattatgag
agcggctacaacaccacagcccagacggtcctggatgacggcagcatcgactatggcatc
ttccagatcaacagcttcgcgtggtgcagacgcggaaagctgaaggagaacaaccactgc
catgtcgcctgctcagccttgatcactgatgacctcacagatgcaattatctgtgccagg
aaaattgttaaagagacacaaggaatgaactattggcaaggctggaagaaacattgtgag
ggcagagacctgtccgagtggaaaaaaggctgtgaggtttcctaa

DBGET integrated database retrieval system