KEGG   Homo sapiens (human): 84572Help
Entry
84572             CDS       T01001                                 

Gene name
GNPTG, C16orf27, GNPTAG, LP2537, RJD9
Definition
N-acetylglucosamine-1-phosphate transferase, gamma subunit
Orthology
K10087  
N-acetylglucosamine-1-phosphate transferase, gamma subunit
Organism
hsa  Homo sapiens (human)
Pathway
Lysosome
Disease
H00143  
Mucolipidosis II and III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    84572 (GNPTG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 305 aa AA seqDB search
MAAGLARLLLLLGLSAGGPAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSG
PVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTG
MWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTL
PEALQRQWDQVEQDLADELITPQGHEKLLRTLFEDAGYLKTPEENEPTQLEGGPDSLGFE
TLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPG
LRGSL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggggctggcgcggctcctgttgctcctcgggctctcggccggcgggcccgcg
ccggcaggtgcagcgaagatgaaggtggtggaggagcccaacgcgtttggggtgaacaac
ccgttcttgcctcaggccagtcgcctccaggccaagagggatccttcacccgtgtctgga
cccgtgcatctcttccgactctcgggcaagtgcttcagcctggtggagtccacgtacaag
tatgagttctgcccgttccacaacgtgacccagcacgagcagaccttccgctggaacgcc
tacagtgggatcctcggcatctggcacgagtgggagatcgccaacaacaccttcacgggc
atgtggatgagggacggtgacgcctgccgttcccggagccggcagagcaaggtggagctg
gcgtgtggaaaaagcaaccggctggcccatgtgtccgagccgagcacctgcgtctacgcg
ctgacgttcgagacccccctcgtctgccacccccacgccttgctagtgtacccaaccctg
ccagaggccctgcagcggcagtgggaccaggtagagcaggacctggccgatgagctgatc
accccccagggccatgagaagttgctgaggacactttttgaggatgctggctacttaaag
accccagaagaaaatgaacccacccagctggagggaggtcctgacagcttggggtttgag
accctggaaaactgcaggaaggctcataaagaactctcaaaggagatcaaaaggctgaaa
ggtttgctcacccagcacggcatcccctacacgaggcccacagaaacttccaacttggag
cacttgggccacgagacgcccagagccaagtctccagagcagctgcggggtgacccagga
ctgcgtgggagtttgtga

DBGET integrated database retrieval system