KEGG   Homo sapiens (human): 846Help
Entry
846               CDS       T01001                                 

Gene name
CASR, CAR, EIG8, FHH, FIH, GPRC2A, HHC, HHC1, HYPOC1, NSHPT, PCAR1, hCasR
Definition
(RefSeq) calcium sensing receptor
  KO
K04612  
calcium-sensing receptor
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Disease
H00239  
Bartter syndrome
H00245  
Calcium sensing receptor (CASR) related disease
H00246  
Primary hyperparathyroidism
H01558  
Parathyroid carcinoma
Drug target
Cinacalcet (DG00513): 
Etelcalcetide (DG01856): 
Tecalcet hydrochloride: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    846 (CASR)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Calcium-sensing
   Extracellular calcium-sensing
    846 (CASR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Pharos: 
P41180(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
3q13.33-q21.1
AA seq 1078 aa AA seqDB search
MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA
SSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHL
QEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQP
RCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGE
TDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGGGSTVTENVVNS
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggcattttatagctgctgctgggtcctcttggcactcacctggcacacctctgcctac
gggccagaccagcgagcccaaaagaagggggacattatccttggggggctctttcctatt
cattttggagtagcagctaaagatcaagatctcaaatcaaggccggagtctgtggaatgt
atcaggtataatttccgtgggtttcgctggttacaggctatgatatttgccatagaggag
ataaacagcagcccagcccttcttcccaacttgacgctgggatacaggatatttgacact
tgcaacaccgtttctaaggccttggaagccaccctgagttttgttgctcaaaacaaaatt
gattctttgaaccttgatgagttctgcaactgctcagagcacattccctctacgattgct
gtggtgggagcaactggctcaggcgtctccacggcagtggcaaatctgctggggctcttc
tacattccccaggtcagttatgcctcctccagcagactcctcagcaacaagaatcaattc
aagtctttcctccgaaccatccccaatgatgagcaccaggccactgccatggcagacatc
atcgagtatttccgctggaactgggtgggcacaattgcagctgatgacgactatgggcgg
ccggggattgagaaattccgagaggaagctgaggaaagggatatctgcatcgacttcagt
gaactcatctcccagtactctgatgaggaagagatccagcatgtggtagaggtgattcaa
aattccacggccaaagtcatcgtggttttctccagtggcccagatcttgagcccctcatc
aaggagattgtccggcgcaatatcacgggcaagatctggctggccagcgaggcctgggcc
agctcctccctgatcgccatgcctcagtacttccacgtggttggcggcaccattggattc
gctctgaaggctgggcagatcccaggcttccgggaattcctgaagaaggtccatcccagg
aagtctgtccacaatggttttgccaaggagttttgggaagaaacatttaactgccacctc
caagaaggtgcaaaaggacctttacctgtggacacctttctgagaggtcacgaagaaagt
ggcgacaggtttagcaacagctcgacagccttccgacccctctgtacaggggatgagaac
atcagcagtgtcgagaccccttacatagattacacgcatttacggatatcctacaatgtg
tacttagcagtctactccattgcccacgccttgcaagatatatatacctgcttacctggg
agagggctcttcaccaatggctcctgtgcagacatcaagaaagttgaggcgtggcaggtc
ctgaagcacctacggcatctaaactttacaaacaatatgggggagcaggtgacctttgat
gagtgtggtgacctggtggggaactattccatcatcaactggcacctctccccagaggat
ggctccatcgtgtttaaggaagtcgggtattacaacgtctatgccaagaagggagaaaga
ctcttcatcaacgaggagaaaatcctgtggagtgggttctccagggaggtgcccttctcc
aactgcagccgagactgcctggcagggaccaggaaagggatcattgagggggagcccacc
tgctgctttgagtgtgtggagtgtcctgatggggagtatagtgatgagacagatgccagt
gcctgtaacaagtgcccagatgacttctggtccaatgagaaccacacctcctgcattgcc
aaggagatcgagtttctgtcgtggacggagccctttgggatcgcactcaccctctttgcc
gtgctgggcattttcctgacagcctttgtgctgggtgtgtttatcaagttccgcaacaca
cccattgtcaaggccaccaaccgagagctctcctacctcctcctcttctccctgctctgc
tgcttctccagctccctgttcttcatcggggagccccaggactggacgtgccgcctgcgc
cagccggcctttggcatcagcttcgtgctctgcatctcatgcatcctggtgaaaaccaac
cgtgtcctcctggtgtttgaggccaagatccccaccagcttccaccgcaagtggtggggg
ctcaacctgcagttcctgctggttttcctctgcaccttcatgcagattgtcatctgtgtg
atctggctctacaccgcgcccccctcaagctaccgcaaccaggagctggaggatgagatc
atcttcatcacgtgccacgagggctccctcatggccctgggcttcctgatcggctacacc
tgcctgctggctgccatctgcttcttctttgccttcaagtcccggaagctgccggagaac
ttcaatgaagccaagttcatcaccttcagcatgctcatcttcttcatcgtctggatctcc
ttcattccagcctatgccagcacctatggcaagtttgtctctgccgtagaggtgattgcc
atcctggcagccagctttggcttgctggcgtgcatcttcttcaacaagatctacatcatt
ctcttcaagccatcccgcaacaccatcgaggaggtgcgttgcagcaccgcagctcacgct
ttcaaggtggctgcccgggccacgctgcgccgcagcaacgtctcccgcaagcggtccagc
agccttggaggctccacgggatccaccccctcctcctccatcagcagcaagagcaacagc
gaagacccattcccacagcccgagaggcagaagcagcagcagccgctggccctaacccag
caagagcagcagcagcagcccctgaccctcccacagcagcaacgatctcagcagcagccc
agatgcaagcagaaggtcatctttggcagcggcacggtcaccttctcactgagctttgat
gagcctcagaagaacgccatggcccacaggaattctacgcaccagaactccctggaggcc
cagaaaagcagcgatacgctgacccgacaccagccattactcccgctgcagtgcggggaa
acggacttagatctgaccgtccaggaaacaggtctgcaaggacctgtgggtggagaccag
cggccagaggtggaggaccctgaagagttgtccccagcacttgtagtgtccagttcacag
agctttgtcatcagtggtggaggcagcactgttacagaaaacgtagtgaattcataa

DBGET integrated database retrieval system