KEGG   Homo sapiens (human): 846Help
Entry
846               CDS       T01001                                 

Gene name
CASR, CAR, EIG8, FHH, FIH, GPRC2A, HHC, HHC1, HYPOC1, NSHPT, PCAR1
Definition
(RefSeq) calcium sensing receptor
  KO
K04612  
calcium-sensing receptor
Organism
hsa  Homo sapiens (human)
Disease
H00239  
Bartter syndrome
H00245  
Familial hypocalciuric hypercalcemia (FHH1)
H01558  
Parathyroid carcinoma
Drug target
Cinacalcet [DG:DG00513]: 
Other: 
Brite
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Calcium-sensing
   Extracellular calcium-sensing
    846 (CASR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q13
AA seq 1078 aa AA seqDB search
MAFYSCCWVLLALTWHTSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVEC
IRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKI
DSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQF
KSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFS
ELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWA
SSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHL
QEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFD
ECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFS
NCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIA
KEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLC
CFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWG
LNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYT
CLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVSRKRSS
SLGGSTGSTPSSSISSKSNSEDPFPQPERQKQQQPLALTQQEQQQQPLTLPQQQRSQQQP
RCKQKVIFGSGTVTFSLSFDEPQKNAMAHRNSTHQNSLEAQKSSDTLTRHQPLLPLQCGE
TDLDLTVQETGLQGPVGGDQRPEVEDPEELSPALVVSSSQSFVISGGGSTVTENVVNS
NT seq 3237 nt NT seq  +upstreamnt  +downstreamnt
atggcattttatagctgctgctgggtcctcttggcactcacctggcacacctctgcctac
gggccagaccagcgagcccaaaagaagggggacattatccttggggggctctttcctatt
cattttggagtagcagctaaagatcaagatctcaaatcaaggccggagtctgtggaatgt
atcaggtataatttccgtgggtttcgctggttacaggctatgatatttgccatagaggag
ataaacagcagcccagcccttcttcccaacttgacgctgggatacaggatatttgacact
tgcaacaccgtttctaaggccttggaagccaccctgagttttgttgctcaaaacaaaatt
gattctttgaaccttgatgagttctgcaactgctcagagcacattccctctacgattgct
gtggtgggagcaactggctcaggcgtctccacggcagtggcaaatctgctggggctcttc
tacattccccaggtcagttatgcctcctccagcagactcctcagcaacaagaatcaattc
aagtctttcctccgaaccatccccaatgatgagcaccaggccactgccatggcagacatc
atcgagtatttccgctggaactgggtgggcacaattgcagctgatgacgactatgggcgg
ccggggattgagaaattccgagaggaagctgaggaaagggatatctgcatcgacttcagt
gaactcatctcccagtactctgatgaggaagagatccagcatgtggtagaggtgattcaa
aattccacggccaaagtcatcgtggttttctccagtggcccagatcttgagcccctcatc
aaggagattgtccggcgcaatatcacgggcaagatctggctggccagcgaggcctgggcc
agctcctccctgatcgccatgcctcagtacttccacgtggttggcggcaccattggattc
gctctgaaggctgggcagatcccaggcttccgggaattcctgaagaaggtccatcccagg
aagtctgtccacaatggttttgccaaggagttttgggaagaaacatttaactgccacctc
caagaaggtgcaaaaggacctttacctgtggacacctttctgagaggtcacgaagaaagt
ggcgacaggtttagcaacagctcgacagccttccgacccctctgtacaggggatgagaac
atcagcagtgtcgagaccccttacatagattacacgcatttacggatatcctacaatgtg
tacttagcagtctactccattgcccacgccttgcaagatatatatacctgcttacctggg
agagggctcttcaccaatggctcctgtgcagacatcaagaaagttgaggcgtggcaggtc
ctgaagcacctacggcatctaaactttacaaacaatatgggggagcaggtgacctttgat
gagtgtggtgacctggtggggaactattccatcatcaactggcacctctccccagaggat
ggctccatcgtgtttaaggaagtcgggtattacaacgtctatgccaagaagggagaaaga
ctcttcatcaacgaggagaaaatcctgtggagtgggttctccagggaggtgcccttctcc
aactgcagccgagactgcctggcagggaccaggaaagggatcattgagggggagcccacc
tgctgctttgagtgtgtggagtgtcctgatggggagtatagtgatgagacagatgccagt
gcctgtaacaagtgcccagatgacttctggtccaatgagaaccacacctcctgcattgcc
aaggagatcgagtttctgtcgtggacggagccctttgggatcgcactcaccctctttgcc
gtgctgggcattttcctgacagcctttgtgctgggtgtgtttatcaagttccgcaacaca
cccattgtcaaggccaccaaccgagagctctcctacctcctcctcttctccctgctctgc
tgcttctccagctccctgttcttcatcggggagccccaggactggacgtgccgcctgcgc
cagccggcctttggcatcagcttcgtgctctgcatctcatgcatcctggtgaaaaccaac
cgtgtcctcctggtgtttgaggccaagatccccaccagcttccaccgcaagtggtggggg
ctcaacctgcagttcctgctggttttcctctgcaccttcatgcagattgtcatctgtgtg
atctggctctacaccgcgcccccctcaagctaccgcaaccaggagctggaggatgagatc
atcttcatcacgtgccacgagggctccctcatggccctgggcttcctgatcggctacacc
tgcctgctggctgccatctgcttcttctttgccttcaagtcccggaagctgccggagaac
ttcaatgaagccaagttcatcaccttcagcatgctcatcttcttcatcgtctggatctcc
ttcattccagcctatgccagcacctatggcaagtttgtctctgccgtagaggtgattgcc
atcctggcagccagctttggcttgctggcgtgcatcttcttcaacaagatctacatcatt
ctcttcaagccatcccgcaacaccatcgaggaggtgcgttgcagcaccgcagctcacgct
ttcaaggtggctgcccgggccacgctgcgccgcagcaacgtctcccgcaagcggtccagc
agccttggaggctccacgggatccaccccctcctcctccatcagcagcaagagcaacagc
gaagacccattcccacagcccgagaggcagaagcagcagcagccgctggccctaacccag
caagagcagcagcagcagcccctgaccctcccacagcagcaacgatctcagcagcagccc
agatgcaagcagaaggtcatctttggcagcggcacggtcaccttctcactgagctttgat
gagcctcagaagaacgccatggcccacaggaattctacgcaccagaactccctggaggcc
cagaaaagcagcgatacgctgacccgacaccagccattactcccgctgcagtgcggggaa
acggacttagatctgaccgtccaggaaacaggtctgcaaggacctgtgggtggagaccag
cggccagaggtggaggaccctgaagagttgtccccagcacttgtagtgtccagttcacag
agctttgtcatcagtggtggaggcagcactgttacagaaaacgtagtgaattcataa

DBGET integrated database retrieval system