KEGG   Homo sapiens (human): 84612Help
Entry
84612             CDS       T01001                                 

Gene name
PARD6B, PAR6B
Definition
(RefSeq) par-6 family cell polarity regulator beta
  KO
K06093  
partitioning defective protein 6
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Endocytosis
Axon guidance
Hippo signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    84612 (PARD6B)
   04390 Hippo signaling pathway
    84612 (PARD6B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84612 (PARD6B)
  Cellular commiunity
   04530 Tight junction
    84612 (PARD6B)
 Organismal Systems
  Development
   04360 Axon guidance
    84612 (PARD6B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     84612 (PARD6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.13
AA seq 372 aa AA seqDB search
MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIEPSFEPEDEDSEEDDIIIED
NGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSNTEFETHAPDQ
KLLEEDGTIITL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcagccaccggcacggggcgggcagcggctgcctgggcactatggaggtgaag
agcaagtttggagctgaatttcgtcggttttcgctggaaagatcaaaacctggaaaattt
gaggagttttatggattactacaacatgttcataagatccccaatgttgacgttttggta
ggctatgcagacatccatggagacttactacctataaataatgatgataattatcacaaa
gctgtttcaacggccaatccactgcttaggatatttatacaaaagaaggaagaagcagac
tacagtgcctttggtacagacacgctaataaagaagaagaatgttttaaccaacgtattg
cgtcctgacaaccatagaaaaaagccacatatagtcattagtatgccccaagactttaga
cctgtgtcttctattatagacgtggatattctcccagaaacgcatcgtagggtacgtctt
tacaaatacggcacggagaaacccctaggattctacatccgggatggctccagtgtcagg
gtaacaccacatggcttagaaaaggttccagggatctttatatccaggcttgtcccagga
ggtctggctcaaagtacaggactattagctgttaatgatgaagttttagaagttaatggc
atagaagtttcagggaagagccttgatcaagtaacagacatgatgattgcaaatagccgt
aacctcatcataacagtgagaccggcaaaccagaggaataatgttgtgaggaacagtcgg
acttctggcagttccggtcagtctactgataacagccttcttggctacccacagcagatt
gaaccaagctttgagccagaggatgaagacagcgaagaagatgacattatcattgaagac
aatggagtgccacagcagattccaaaagctgttcctaatactgagagcctggagtcatta
acacagatagagctaagctttgagtctggacagaatggctttattccctctaatgaagtg
agcttagcagccatagcaagcagctcaaacacggaatttgaaacacatgctccagatcaa
aaactcttagaagaagatggaacaatcataacattatga

DBGET integrated database retrieval system