KEGG   Homo sapiens (human): 84612Help
Entry
84612             CDS       T01001                                 

Gene name
PARD6B, PAR6B
Definition
(RefSeq) par-6 family cell polarity regulator beta
  KO
K06093  
partitioning defective protein 6
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Endocytosis
Axon guidance
Hippo signaling pathway
Tight junction
Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    84612 (PARD6B)
   04390 Hippo signaling pathway
    84612 (PARD6B)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    84612 (PARD6B)
  Cellular community - eukaryotes
   04530 Tight junction
    84612 (PARD6B)
 Organismal Systems
  Development
   04360 Axon guidance
    84612 (PARD6B)
 Human Diseases
  Infectious diseases
   05165 Human papillomavirus infection
    84612 (PARD6B)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Centriolar satellite
     84612 (PARD6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9BYG5(Tbio)
UniProt: 
Position
20q13.13
AA seq 372 aa AA seqDB search
MNRSHRHGAGSGCLGTMEVKSKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLV
GYADIHGDLLPINNDDNYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVL
RPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRVRLYKYGTEKPLGFYIRDGSSVR
VTPHGLEKVPGIFISRLVPGGLAQSTGLLAVNDEVLEVNGIEVSGKSLDQVTDMMIANSR
NLIITVRPANQRNNVVRNSRTSGSSGQSTDNSLLGYPQQIEPSFEPEDEDSEEDDIIIED
NGVPQQIPKAVPNTESLESLTQIELSFESGQNGFIPSNEVSLAAIASSSNTEFETHAPDQ
KLLEEDGTIITL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcagccaccggcacggggcgggcagcggctgcctgggcactatggaggtgaag
agcaagtttggagctgaatttcgtcggttttcgctggaaagatcaaaacctggaaaattt
gaggagttttatggattactacaacatgttcataagatccccaatgttgacgttttggta
ggctatgcagacatccatggagacttactacctataaataatgatgataattatcacaaa
gctgtttcaacggccaatccactgcttaggatatttatacaaaagaaggaagaagcagac
tacagtgcctttggtacagacacgctaataaagaagaagaatgttttaaccaacgtattg
cgtcctgacaaccatagaaaaaagccacatatagtcattagtatgccccaagactttaga
cctgtgtcttctattatagacgtggatattctcccagaaacgcatcgtagggtacgtctt
tacaaatacggcacggagaaacccctaggattctacatccgggatggctccagtgtcagg
gtaacaccacatggcttagaaaaggttccagggatctttatatccaggcttgtcccagga
ggtctggctcaaagtacaggactattagctgttaatgatgaagttttagaagttaatggc
atagaagtttcagggaagagccttgatcaagtaacagacatgatgattgcaaatagccgt
aacctcatcataacagtgagaccggcaaaccagaggaataatgttgtgaggaacagtcgg
acttctggcagttccggtcagtctactgataacagccttcttggctacccacagcagatt
gaaccaagctttgagccagaggatgaagacagcgaagaagatgacattatcattgaagac
aatggagtgccacagcagattccaaaagctgttcctaatactgagagcctggagtcatta
acacagatagagctaagctttgagtctggacagaatggctttattccctctaatgaagtg
agcttagcagccatagcaagcagctcaaacacggaatttgaaacacatgctccagatcaa
aaactcttagaagaagatggaacaatcataacattatga

DBGET integrated database retrieval system