KEGG   Homo sapiens (human): 84618Help
Entry
84618             CDS       T01001                                 

Gene name
NT5C1A, CN-I, CN-IA, CN1, CN1A, CNI
Definition
5'-nucleotidase, cytosolic IA (EC:3.1.3.5)
Orthology
K01081  
5'-nucleotidase [EC:3.1.3.5]
Organism
hsa  Homo sapiens (human)
Pathway
Purine metabolism
Pyrimidine metabolism
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:hsa00240]
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:hsa00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p34.3-p33
AA seq 368 aa AA seqDB search
MEPGQPREPQEPREPGPGAETAAAPVWEEAKIFYDNLAPKKKPKSPKPQNAVTIAVSSRA
LFRMDEEQQIYTEQGVEEYVRYQLEHENEPFSPGPAFPFVKALEAVNRRLRELYPDSEDV
FDIVLMTNNHAQVGVRLINSINHYDLFIERFCMTGGNSPICYLKAYHTNLYLSADAEKVR
EAIDEGIAAATIFSPSRDVVVSQSQLRVAFDGDAVLFSDESERIVKAHGLDRFFEHEKAH
ENKPLAQGPLKGFLEALGRLQKKFYSKGLRLECPIRTYLVTARSAASSGARALKTLRSWG
LETDEALFLAGAPKGPLLEKIRPHIFFDDQMFHVAGAQEMGTVAAHVPYGVAQTPRRTAP
AKQAPSAQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggaacctgggcagccccgggagccccaggagccccgcgagcccgggccaggagcggag
accgctgcggccccggtctgggaggaagccaagattttctacgacaacctcgcgcccaag
aagaaacccaaatcgcccaagcctcagaatgcagtcaccatcgctgtgtcctcccgagcc
ttgtttcgcatggacgaggagcagcagatctacacggagcagggcgtggaggagtacgtg
cgctaccagctggaacatgagaacgaacccttcagtcccgggccagccttcccttttgtg
aaggctctggaggccgtgaacaggcggctgcgggagctgtaccctgatagtgaggacgtc
ttcgacatcgtcctcatgactaacaaccatgctcaagtgggtgtccgcctcatcaacagt
atcaaccactatgacctgttcatcgagaggttctgcatgacaggtgggaacagcccgatc
tgctacctcaaggcctatcacaccaacctctacttgtcagccgatgcggaaaaagtgcga
gaagccattgatgaggggatcgcagctgccaccatcttcagccccagcagggatgtggtt
gtgtcccagagtcagctgcgcgtggccttcgatggggacgccgtgctcttctcggacgag
tcggagcgcatcgtcaaggcccacgggctggaccgattcttcgagcatgagaaggcccac
gagaacaagcctctggctcagggccccttaaagggctttctggaggcactgggtaggttg
cagaagaagttctactccaaaggcctgcggctggagtgcccaattcgtacctacttggtg
acagcacgcagtgcagccagttccggggcccgggctctcaagaccctgcgcagctggggc
ctggagacagatgaagccttgttccttgctggagcgcccaagggccctctccttgagaag
atccgcccacacatcttctttgatgaccagatgttccatgtggctggggctcaggagatg
ggcactgtggccgcccatgtgccttatggtgtggcacagacaccccggcggactgcacct
gcaaagcaggccccatctgcacagtag

DBGET integrated database retrieval system