KEGG   Homo sapiens (human): 84627Help
Entry
84627             CDS       T01001                                 

Gene name
ZNF469, BCS
Definition
zinc finger protein 469
Organism
hsa  Homo sapiens (human)
Disease
H00802  
Ehlers-Danlos syndrome (EDS)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
UniProt: 
Position
16q24
AA seq 3925 aa AA seqDB search
MPGERPRGAPPPTMTGDLQPRQVASSPGHPSQPPLEDNTPATRTTKGAREAGGQAQAMEL
PEAQPRQARDGELKPPSLRGQAPSSTPGKRGSPQTPPGRSPLQAPSRLAGRAEGSPPQRY
ILGIASSRTKPTLDETPENPQLEAAQLPEVDTPQGPGTGAPLRPGLPRTEAQPAAEELGF
HRCFQEPPSSFTSTNYTSPSATPRPPAPGPPQSRGTSPLQPGSYPEYQASGADSWPPAAE
NSFPGANFGVPPAEPEPIPKGSRPGGSPRGVSFQFPFPALHGASTKPFPADVAGHAFTNG
PLVFAFHQPQGAWPEEAVGTGPAYPLPTQPAPSPLPCYQGQPGGLNRHSDLSGALSSPGA
AHSAPRPFSDSLHKSLTKILPERPPSAQDGLGSTRGPPSSLPQRHFPGQAYRASGVDTSP
GPPDTELAAPGPPPARLPQLWDPTAAPYPTPPGGPLAATRSMFFNGQPSPGQRLCLPQSA
PLPWPQVLPTARPSPHGMEMLSRLPFPAGGPEWQGGSQGALGTAGKTPGPREKLPAVRSS
QGGSPALFTYNGMTDPGAQPLFFGVAQPQVSPHGTPSLPPPRVVGASPSESPLPSPATNT
AGSTCSSLSPMSSSPANPSSEESQLPGPLGPSAFFHPPTHPQETGSPFPSPEPPHSLPTH
YQPEPAKAFPFPADGLGAEGAFQCLEETPFPHEGPEVGRGGLQGFPRAPPPYPTHHFSLS
SASLDQLDVLLTCRQCDRNYSSLAAFLAHRQFCGLLLARAKDGHQRSPGPPGLPSPPAAP
RVPADAHAGLLSHAKTFLLAGDAQAEGKDDPLRTGFLPSLAATPFPLPASDLDMEDDAKL
DSLITEALNGMEYQSDNPEIDSSFIDVFADEEPSGPRGPSSGHPLKSKAGVTPESKAPPP
LPAATPDPQTPRPGDRGCPARGRPKTRSLGLAPTEADAPSQGRQQRRGKQLKLFRKDLDS
GGAAEGSGSGGGGRASGLRPRRNDGLGERPPPRPRRPRTQAPGSRADPAPRVPRAAALPE
ETRSSRRRRLPPRKDPRKRKARGGAWGKELILKIVQQKNRLREYDFASESEEDEQPPPRG
PGFRGRRGRGEKRKEVELTQGPREDEPQKPRKAARQEAGGDGAPANPEEPGGSRPGPGRS
PQARGPSRSLETGAAAREGGPKCADRPSVAPKDPLQVPTNTETSEETRPSLDFPQEAKEP
ETAEESAPDSTEFTEALRSPPAACAGEMGASPGLLIPEQPPPSRHDTGTPKPSGSLANTA
PHGSSPTPGVGSLLGGPGGTQAPVSHNSKDPPARQPGEFLAPVANPSSTACPKPSVLSSK
ISSFGCDPAGFNRDPLGVPVAKKGPQPYSSPHSELFLGPKDLAGCFLEELHPKPSARDAP
PASSSCLCQDGEDAGSLEPQLPRSPPGTAETEPGRAASPPTLESSSLFPDLPVDRFDPPL
YGSLSANRDSGLPFACADPPQKTVPSDPPYPSFLLLEEVSPMLPSHFPDLSGGKVLSKTC
PPERTVVPGAAPSLPGKGSGCSVALMSHLSEDELEIQKLVTELESQLQRSKDTRGAPREL
AEAESVGRVELGTGTEPPSQRRTCQATVPHEDTFSAADLTRVGESTAHREGAESAVATVE
AVQGRPGGTWPCPASFHPGHAALLPCAQEDLVSGAPFSPRGANFHFQPVQKAGASKTGLC
QAEGDSRPPQDVCLPEPSKQPGPQLDAGSLAKCSPDQELSFPKNKEAASSQESEDSLRLL
PCEQRGGFLPEPGTADQPHRGAPAPEAFGSPAVHLAPDLAFQGDGAPPLDATWPFGASPS
HAAQGHSAGRAGGHLHPTAGRPGFEGNEFAPAGASSLTAPRGREAWLVPVPSPACVSNTH
PSRRSQDPALSPPIRQLQLPGPGVAKSKDGILGLQELTPAAQSPPRVNPSGLEGGTVEGG
KVACGPAQGSPGGVQVTTLPAVAGHQLGLEADGHWGLLGQAEKTQGQGTANQLQPENGVS
PGGTDNHASVNASPKTALTGPTEGAVLLEKCKGSRAAMSLQEEAEPTPSPPSPNRESLAL
ALTAAHSRSGSEGRTPERASSPGLNKPLLATGDSPAPSVGDLAACAPSPTSAAHMPCSLG
PLPREDPLTSPSRAQGGLGGQLPASPSCRDPPGPQQLLACSPAWAPLEEADGVQATTDTG
AEDSPVAPPSLTTSPCDPKEALAGCLLQGEGSPLEDPSSWPPGSVSAVTCTHSGDTPKDS
TLRIPEDSRKEKLWESPGRATSPPLAGAVSPSVAVRATGLSSTPTGDEAQAGRGLPGPDP
QSRGAPPHTNPDRMPRGHSSYSPSNTARLGHREGQAVTAVPTEPPTLQGAGPDSPACLEG
EMGTSSKEPEDPGTPETGRSGATKMPRVTCPSTGLGLGRTTAPSSTASDFQSDSPQSHRN
ASHQTPQGDPLGPQDLKQRSRGYKKKPASTENGQWKGQAPHGPVTCEVCAASFRSGPGLS
RHKARKHRPHPGAPAEPSPAALPAQQPLEPLAQKCQPPRKKSHRVSGKERPNHSRGDPSH
VTQPPPAQGSKEVLRAPGSPHSQQLHPPSPTEHEVDVKTPASKPRPDQAREDELHPKQAE
KREGRRWRREPTVDSPSHSEGKSNKKRGKLRGRRLREESILPVSADVISDGRGSRPSPAM
ASYAASPSHCLSVEGGPEADGEQPPRLATLGPGVMEGAAETDQEALCAGETGAQKPPGDR
MLCPGRMDGAALGEQPTGQKGASARGFWGPRETKALGVCKESGSEPAEDSSRAHSRSEEG
VWEENTPPLGPLGFPETSSSPADSTTSSCLQGLPDNPDTQGGVQGPEGPTPDASGSSAKD
PPSLFDDEVSFSQLFPPGGRLTRKRNPHVYGKRCEKPVLPLPTQPSFEEGGDPTLGPARL
PTDLSDSSSLCLCHEDPWEDEDPAGLPESFLLDGFLNSRVPGIDPWAPGLSLWALEPSRE
AGAEKLPSHCPEDDRPEAIPELHMVPAAWRGLEMPAPADDSSSSLGDVSPEPPSLERERC
DGGLPGNTHLLPLRATDFEVLSTKFEMQDLCFLGPFEDPVGLPGPSFLDFEGTASSQGPQ
SRRTEEAAGAGRAQGRGRPAKGRRASYKCKVCFQRFRSLGELDLHKLAHTPAPPPTCYMC
VERRFGSRELLRGHLQERHAQSKAGPWACGMCLKEVADVWMYNEHLREHAVRFARRGQAR
RSLGDLPGGLEGSSAVAHLLNSITEPAPKHHRGKRSAGKAAGSPGDPWGQEGEAKKDSPG
ERAKPRARSTPSNPDGAATPDSASATALADAGSPGPPRTTPSPSPDPWAGGEPLLQATPV
HEACKDPSRDCHHCGKRFPKPFKLQRHLAVHSPQRVYLCPRCPRVYPEHGELLAHLGGAH
GLLERPELQHTPLYACELCATVMRIIKKSFACSSCNYTFAKKEQFDRHMNKHLRGGRQPF
AFRGVRRPGAPGQKARALEGTLPSKRRRVAMPGSAPGPGEDRPPPRGSSPILSEGSLPAL
LHLCSEVAPSTTKGWPETLERPVDPVTHPIRGCELPSNHQECPPPSLSPFPAALADGRGD
CALDGALERPENEASPGSPGPLLQQALPLGASLPRPGARGQDAEGKRAPLVFSGKRRAPG
ARGRCAPDHFQEDHLLQKEKEVSSSHMVSEGGPRGTFHKGSATKPAGCQSSSKDRSAAST
PSKALKFPVHPRKAVGSLAPGELARGTENGMKPATPKAKPGPSSQGSGSPRPGTKTGGGS
QPQPASGQLQSETATTPAKPSFPSRSPAPERLPARAQAKSCTKGPREAGEQGPHGSLGPK
EKGESSTKRKKGQVPGPARSESVGSFGRAPSAPDKPPRTPRKQATPSRVLPTKPKPNSQN
KPRPPPSEQRKAEPGHTQRKDRLGKAFPQGRPLLRPPKRGTAVHGAEPAEPHTHRTAEAQ
SDLLSQLFGQRLTGFKIPLKKDASE
NT seq 11778 nt NT seq  +upstreamnt  +downstreamnt
atgcctggggagcgcccccgaggagcgccgccccccaccatgactggagacctgcagccc
cgccaagttgccagcagcccggggcacccctcccagccgccactggaggacaacacccca
gctaccaggaccaccaagggtgccagggaggctggcggccaggcccaggccatggagctc
cccgaggcccagccaaggcaggccagggacggggagctcaagcccccatccctgagaggc
caggccccgagcagcacccctgggaagaggggcagcccccagaccccaccggggagaagc
cccttgcaggctccctcaaggctggcgggcagggcagagggcagccccccacagcgctac
attctgggcatcgccagctcgaggaccaagcccaccctggacgagacaccagagaaccca
cagctggaggctgcccagctccctgaggtggacaccccccagggccctgggactggagct
ccactcaggccgggcctcccaaggactgaggcccaacccgccgccgaagagcttggcttc
cacaggtgcttccaggagccaccctccagctttacctccaccaactatacctcaccaagc
gccacccccaggcccccagccccggggcccccccagagcaggggcaccagccccctccag
cccggttcctatcccgaataccaggccagtggggccgactcctggcctcccgctgctgag
aatagcttcccaggtgctaatttcggggttccccccgccgagccggaacctattcccaaa
ggcagcaggcccggcggcagccccaggggagtttccttccagttccccttcccggcactg
catggggccagcacaaaacccttccctgcggatgtggctgggcacgcattcaccaatggg
ccactggtgtttgccttccatcagccccagggagcgtggccggaggaggccgtgggcacg
ggccctgcctacccgctgcccacccagcctgcgccctcacccctgccctgctaccagggc
cagccaggtggcctgaaccgccacagcgacctcagtggtgccctctcttcccctggagct
gctcactcggccccgagacccttctctgacagtttacacaagagcctgaccaaaatcctt
cccgaaagaccaccttcagcccaggatgggctggggagcacgagagggccccctagctcc
ctaccccagaggcactttccagggcaggcgtacagagccagtggggtggacaccagcccg
gggcctccggacaccgagctggccgccccagggcccccacccgccaggctgccccagctg
tgggaccccacagcagccccttaccccacacctcctgggggccccctggctgccaccagg
agtatgttctttaacggccagcccagcccaggccagcggctctgcctcccccagagtgcc
cccctgccttggccccaagtgctcccgaccgcccggccaagtccccacggaatggagatg
ctgagccggctgcctttccccgcggggggccccgagtggcaggggggcagccaaggagcc
ctgggcactgctggcaagacaccgggacccagagagaagctgccagccgtgagaagcagc
cagggcggctccccagcactgttcacctacaacggaatgacagaccctggggctcagccc
ctgttcttcggggtggcccagccccaggtttcaccccacgggacacccagcctgccccca
ccgagggtagtgggagcctcccccagcgagtccccactgccgtcaccggccaccaacacg
gccggcagcacctgctcttccctgtcgccgatgtccagcagcccagccaaccccagctca
gaggaaagccagctccccggccccctcgggccctcggccttcttccacccacccactcac
ccccaggagacgggcagccccttcccgtccccggagcccccccactccctccccacccac
taccagccagagccagccaaggccttcccttttcccgcagatgggctgggagccgagggt
gccttccagtgcctggaggagaccccattcccccacgagggccccgaggtgggtcgggga
gggctgcagggcttcccccgtgcgccgcctccgtaccccacacaccacttctccctcagc
agcgccagcctggaccagctggacgtgctgctgacctgcaggcagtgtgaccgcaactac
agcagcctggcggccttcctggcccaccggcagttctgtggcctgctcctggccagggcc
aaggatggccaccagcggtctccaggcccccctgggctcccctcgccccccgctgccccc
agagtccctgccgacgcacacgcgggcttgctcagccacgcgaagaccttcctgttagct
ggggacgcccaggccgagggcaaagacgaccccctgaggacaggcttcctgcccagcctg
gccgccacccccttcccgctccctgcctcggacctggacatggaggatgacgccaagctg
gacagcctcatcacagaggcgctcaacggcatggagtaccagtcggacaacccggagatc
gacagcagcttcatcgacgtcttcgcggacgaggagccttccggccccagaggtcccagc
tccggacacccccttaagagcaaggcgggggtgactccagagagcaaagctccgcccccg
ctcccagcagccacgccggacccccaaaccccccgccctggggacaggggctgcccagcc
cgaggcaggcccaaaacgcgttccctgggtctggcccccaccgaggcggatgcgcccagc
cagggcaggcagcagaggagggggaagcagttgaagctgttccggaaggatctggactcg
ggcggcgcagcagaggggtcggggtcgggcggcggcggcagagcctccggcctgaggccc
cggaggaacgacggtctcggggagcggcccccaccccgtccccggcgccctagaacgcag
gcccccgggagccgcgcagaccccgcgccccgggtcccgagagccgccgccctccccgag
gagacccgcagctcccggcgccgccggctgccccccaggaaggaccccaggaagaggaag
gctcggggcggcgcctggggcaaggagctcattctgaagatcgtgcagcagaagaacagg
ctccgcgagtacgacttcgcctcggagtccgaggaggacgagcagcctccgccgcggggc
cccggcttcagaggccggcggggccgaggcgagaagaggaaggaagtggagctgacccag
ggtcccagagaggatgagccacagaaaccccggaaggcggcgaggcaggaagccggcggg
gacggagcccccgcgaaccccgaggagccgggcgggtctcgcccgggccccggcaggagc
cctcaggcccgtggcccgtctcgaagcctggagacgggagcggccgccagggagggaggc
cccaagtgtgctgatcgcccctcagtggcccccaaggatcccctgcaggtccccaccaac
accgagacctcagaggaaacccgcccgtcgctggactttccccaggaggccaaggagcct
gaaactgccgaagagtcagccccggacagcacagaattcacagaggctttgcgttctcct
ccagccgcctgtgcgggagaaatgggagcaagccccggtctcctgataccagagcagccg
ccgcccagcagacatgacaccggcacccccaagccgtcgggaagcctcgccaacacggcg
ccccacggaagctcgccaacgccaggtgtgggcagcctgctgggtggtcctgggggcaca
caggccccagtctcccacaacagcaaggacccccctgcccgccagcctggagaatttctg
gcacccgtggctaacccctcaagtaccgcctgccccaaacccagtgttctgtcttcaaag
atctccagttttggctgtgaccctgctggttttaacagagaccccttgggggttccagtt
gccaaaaaggggcctcagccctacagcagcccccacagtgagttgttcctcggacccaaa
gacctggctggctgtttcctggaagaactgcaccccaagccctcagccagggatgccccg
ccggccagcagctcctgcctttgccaggacggcgaggatgccggttccctcgagccacag
ctgccaaggagcccacctggcaccgctgagacggagccaggcagggctgcatcgccaccg
accttggagtcctcatccctcttcccagacctgccggtggacagattcgacccacccctc
tatggcagcctgtctgcgaacagggactccggtctgccgttcgcatgtgccgaccctccc
cagaagacggtgccgtcagatccaccgtacccctcttttttgctgcttgaggaagtatcc
ccgatgctgcctagccattttcctgatctctcggggggaaaggtgctcagtaagacgtgt
ccccctgaacggacagtggttcccggcgccgccccatctttgcctgggaaggggagtgga
tgtagcgttgctcttatgagtcacctgtccgaggatgaactggagatccagaaattggtc
accgaattagaaagtcagctgcaaaggagcaaagacacacgtggggccccgagagagctt
gcagaagctgagtcggtgggcagggtggagctcggcacaggcacagagccaccctcccaa
cggcgcacctgccaggccaccgtgccccacgaggacacgttctcggcagctgacctcacg
cgcgttggagaatccactgcacatcgggagggtgcggaatcggctgtggccaccgtggaa
gcggttcaggggaggcctggggggacgtggccctgcccagcctccttccatccgggacat
gcagcccttctcccctgtgcccaggaagacctggtttctggggctcctttcagccccagg
ggagccaacttccattttcagccagtgcagaaagccggagcctccaagactggactttgc
caggcagaaggagacagcaggcccccccaagatgtctgcctgcctgagcccagcaagcag
cctggcccacagctggatgccgggagtttagcaaagtgcagccccgaccaggaactttca
tttcctaagaataaggaggccgccagctcacaagaaagtgaagactccctgcggctgctt
ccctgtgaacagagaggagggttcctcccagagcccggcacagcagaccagccccaccga
ggggcccctgctccagaagcttttggcagccctgctgtccatctggcccctgacttggca
tttcagggtgacggggctccacctctggatgccacctggccttttggtgccagtcccagc
catgctgcccagggacattctgcaggcagagcaggtgggcacctccaccccacggcaggg
aggcctggctttgagggtaatgagtttgcaccggcgggggcctcctcactgactgccccc
cggggcagggaggcttggttggtccctgtgccaagtcccgcctgtgtatccaacacccac
cctagcaggaggtcccaggacccagctttgagcccccccatacgtcagctccagctccca
gggcctggagtggctaagagtaaagatggcatcctgggcttgcaggagctgacacctgct
gcccagagccctccacgagtgaacccctcaggtctggaagggggcactgtggaaggaggg
aaggtggcctgtggccccgcccagggctccccagggggtgtgcaggtgacaactctccct
gcagtggccggacatcagctggggctggaggcagatggacattggggcttgcttggccaa
gccgagaaaacccagggccaaggcacagccaaccagcttcagccagagaacggggtgagc
ccagggggcacggacaaccacgcctcagtcaatgccagtcccaaaacagcgctgaccggc
cccaccgagggtgcagtcctgctagagaaatgcaagggaagcagggcagccatgagcctt
caggaggaggccgagcccaccccaagccccccgtcccctaatagggagtccctggcgctg
gccttgacagcagcccacagccgaagtggatctgagggccggactccagagagggcgtcc
agccccggcctgaacaagccactgctggccacaggggatagcccagcaccctctgtcggg
gacctggccgcctgcgccccctcacccacttcagccgcccacatgccctgcagccttggg
cccctgccccgtgaagacccacttacctcgccttccagggcccaaggtgggctggggggg
cagctgccagcatctccgtcctgcagggaccctcccggcccccagcagctgctggcctgt
tctcctgcctgggcacctctggaagaggcagatggcgtccaagccacgacagatactggg
gctgaggattccccggtggctcccccgtctttgacaacaagcccctgcgatcccaaggaa
gccctggctggttgccttctccagggggagggcagccccctggaagacccttcctcctgg
cctcctggctccgtcagtgctgtaacctgcactcacagtggggacacccccaaagacagc
actttaagaattccagaggattccagaaaagagaagctgtgggagtctcctggccgagcc
acctctcctcctctggcaggggccgtctcccccagcgtggccgtcagggctactggcctg
tccagcactcccaccggagatgaggcacaggcaggcaggggactcccagggccagacccc
cagagcaggggagccccgccccacaccaaccctgacaggatgcccaggggccactcctcg
tattctccaagcaatactgcccgcctcggccacagggagggccaggctgtcacagctgtg
cccactgagcctcccacgctacagggtgcagggccggactcccccgcctgcctggaaggt
gagatggggaccagcagcaaggagccggaggacccagggacccctgagaccgggcgctct
ggtgctaccaagatgcccagggtcacctgcccttccacaggactgggcttgggaagaacc
acagccccaagcagcacagccagtgacttccagtctgactccccccaaagccacagaaat
gcctcccaccagactccccagggggaccccctcggcccccaagacctcaaacagaggtcc
cgtggctataaaaagaagcctgcatctacagagaacggccagtggaagggccaagctcca
catgggcctgtgacctgtgaggtctgcgcagcctccttccgctccgggccgggcctgagc
cggcacaaggccaggaagcaccggccacacccgggagcccccgcggagccgagcccagcg
gccttgcctgctcagcagcctctagagcccctagcccaaaagtgccagccgcccaggaag
aaaagccacagggtgtctgggaaggagagaccaaatcactcacggggagaccccagccac
gtcacccagccaccgcctgcccagggctcaaaggaggttctcagagcaccggggtcccca
cacagccagcagctgcaccctccaagccctactgagcatgaggtagatgtgaagactccg
gcctccaagcccagaccagaccaggccagggaagatgagctgcatcccaaacaggcagaa
aaaagagaaggccggaggtggcgccgagagcccaccgtggactctcctagccactcagag
gggaagtcaaataagaaaaggggaaagctgagagggagaaggctccgggaggagagcatt
cttccagtctctgctgatgtgatttcagatgggcgcggctccagaccatcccctgcaatg
gccagttacgcagcctctccgagccactgcctctctgtggaaggagggcctgaggctgac
ggggagcagccgcctcgcttggccactctgggacctggggtgatggagggtgcagcggag
actgaccaggaggctctgtgtgcaggggagactggggcccagaagccacctggagatcgg
atgctgtgtccagggaggatggatggtgcagctctgggggaacagccaactgggcagaag
ggagcctcggcaagggggttctggggaccaagagagaccaaggcgttgggtgtgtgcaaa
gagtctgggagcgagcctgcggaggacagcagcagggcccacagccgatcagaggaaggt
gtctgggaggagaacacgccccccttgggccccctgggttttcccgagacttccagctct
ccggcggacagcaccaccagcagctgcctccagggcctcccggacaacccagacacccag
ggtggagtccaggggcctgaaggccccactcctgatgcctctggctccagtgccaaggat
cctccaagcttgtttgatgatgaggtctctttctcccagctcttccctccaggcggtcgc
ttgactagaaagaggaacccgcatgtctacgggaagcgctgtgagaagccggtgctcccg
ctgccaacccagcccagctttgaggagggcggtgaccccacgctgggcccagcccgcctg
cccacggacctcagcgactccagctccctctgcctctgccatgaggacccgtgggaggac
gaggatcccgcaggtctgcccgagtccttcctcctggatgggttcctcaatagcagggtg
cctggcattgacccctgggcccccggcctcagcctgtgggccctggagcccagcagggaa
gctggtgcagagaagctgccctcccactgccccgaggacgatcggccggaggccattcct
gagctgcacatggtcccagcggcttggcgaggcctggagatgccggcccctgccgatgac
tcctcctcttctctcggagatgtgagccccgagccccccagcctggagagagaacgctgt
gacggtgggcttcccgggaacacccacctgctgccgctccgtgccacggactttgaggtg
ctcagcaccaagtttgagatgcaagacctgtgctttctgggaccctttgaagaccccgtg
ggtctccccggccccagcttcttagacttcgagggcacggcgagctcacaggggccacag
agccgaaggacagaggaggctgcaggggcagggagggcccaaggcagaggccggccggcc
aagggcaggcgggcctcctacaagtgcaaagtgtgcttccagcgcttccgcagcctgggc
gagctggacctgcacaagctggcccacacgcccgcgccgccgcccacctgctacatgtgc
gtggagcgcaggtttggctcgcgggagctgctgcgggggcacctgcaggagaggcacgcg
cagagcaaggccgggccctgggcgtgcggcatgtgcctgaaggaggtggccgacgtctgg
atgtacaacgagcacctgcgtgagcacgcggtccgcttcgcccgcagggggcaggcgcgg
aggtccttgggggacctgcccggaggcctggagggcagcagcgctgtcgcccaccttctg
aacagcatcacggaacccgcgcccaaacaccacaggggcaagcgctccgccggcaaggcc
gccgggagcccgggagacccgtgggggcaagagggagaagccaagaaagacagcccgggc
gagagggcgaaaccccgggcacgcagcacccccagcaacccagacggggccgcgacccca
gacagcgcctctgccaccgccctggctgacgccggcagcccgggcccccccaggacgacc
cccagcccgtcccccgacccctgggccggcggggagcccctcctgcaagccaccccggtg
cacgaggcctgcaaggacccctcccgcgactgccaccactgcgggaagcgcttccccaag
cccttcaagctgcagcgccacctggcggtgcacagcccgcagcgcgtctacctgtgcccc
cggtgcccccgggtctaccccgagcacggggagctgctggcacacctgggcggggcgcac
gggctgctggagcggccggagctgcagcacacgccgctgtatgcctgcgagctctgcgcc
acggttatgcgcatcatcaagaagtccttcgcctgcagctcctgcaactacaccttcgcc
aagaaggagcagttcgaccgccacatgaacaagcacctcaggggggggcggcagcccttc
gcgttccgcggcgtgcggaggccgggagcgccgggacagaaggcccgggccctcgagggc
acactgcccagcaaacggcgcagggtggccatgcccggcagtgcccctgggcccggcgag
gacaggcctcctccccggggaagcagccccatcctgagtgagggctctctcccggccctg
ctccacctgtgttcggaggtggctcccagcaccaccaagggatggcccgagaccctagag
aggcctgtagaccccgtgacccacccgatcagaggttgtgagctgccatccaaccaccag
gagtgtcccccgccgtctctgtctcccttcccagctgccttggctgatggcagaggagac
tgcgcgctggacggagccctggagaggccagagaacgaggcttccccaggcagccccggg
cctcttctccagcaagctctccctctgggggcatctctgccgcggccgggagccagaggc
caagatgcggagggaaagagggctcctctcgtgttctcagggaaacgcagggccccgggt
gcccgtggcaggtgtgcccctgaccatttccaggaagaccacctacttcagaaagagaag
gaggtgtcctcaagccacatggtgtctgagggggggccccgaggcaccttccacaagggc
agcgccaccaagcctgcgggctgccagagctcatcaaaggacaggtcggcagcatccacc
cccagcaaagcactcaagttcccagtgcacccaaggaaggcggtggggagcctggcaccc
ggggagctggcccgtggcacagagaatgggatgaagcccgccacccccaaagccaaaccc
ggccccagctcccagggcagtggaagccctcgccccggcaccaagacaggaggtggcagc
cagccccagccagccagcgggcagctccagagcgagacagccaccaccccagccaagccc
agcttccccagccggagccctgcaccagagaggctccccgctcgagcccaagccaagagc
tgcaccaaggggccaagggaagctggtgagcaggggccccacgggagcctaggtcccaag
gagaagggagagagcagtacgaagaggaaaaagggccaggtcccagggccagccaggagt
gaaagtgtggggagcttcgggagagccccctcagcccctgacaagcccccccggacccct
cggaagcaggcaactcccagccgcgtgctcccgaccaagcccaagcccaacagccagaac
aaacccaggccgccaccatcagagcagcggaaggcagagccgggccacacacagaggaag
gacagactgggcaaggccttcccccaggggagacccctgctcaggccccccaagaggggc
acagctgtccacggtgctgaacctgccgagccacacacccaccggacggccgaggcccag
agtgacctcctcagccagctcttcgggcagagactaactggcttcaaaatccctttaaag
aaagatgcttccgagtaa

DBGET integrated database retrieval system