KEGG   Homo sapiens (human): 84634Help
Entry
84634             CDS       T01001                                 

Gene name
KISS1R, AXOR12, CPPB1, GPR54, HH8, HOT7T175, KISS-1R
Definition
KISS1 receptor
Orthology
K08374  
KISS1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Disease
H00255  
Hypogonadotropic hypogonadism
H00937  
Precocious puberty
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    84634 (KISS1R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Hypothalamic hormone
   Kisspeptin
    84634 (KISS1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 398 aa AA seqDB search
MHTVATSGPNASWGAPANASGCPGCGANASDGPVPSPRAVDAWLVPLFFAALMLLGLVGN
SLVIYVICRHKPMRTVTNFYIANLAATDVTFLLCCVPFTALLYPLPGWVLGDFMCKFVNY
IQQVSVQATCATLTAMSVDRWYVTVFPLRALHRRTPRLALAVSLSIWVGSAAVSAPVLAL
HRLSPGPRAYCSEAFPSRALERAFALYNLLALYLLPLLATCACYAAMLRHLGRVAVRPAP
ADSALQGQVLAERAGAVRAKVSRLVAAVVLLFAACWGPIQLFLVLQALGPAGSWHPRSYA
AYALKTWAHCMSYSNSALNPLLYAFLGSHFRQAFRRVCPCAPRRPRRPRRPGPSDPAAPH
AELLRLGSHPAPARAQKPGSSGLAARGLCVLGEDNAPL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccgtggctacgtccggacccaacgcgtcctggggggcaccggccaacgcctcc
ggctgcccgggctgtggcgccaacgcctcggacggcccagtcccttcgccgcgggccgtg
gacgcctggctcgtgccgctcttcttcgcggcgctgatgctgctgggcctggtggggaac
tcgctggtcatctacgtcatctgccgccacaagccgatgcggaccgtgaccaacttctac
atcgccaacctggcggccacggacgtgaccttcctcctgtgctgcgtccccttcacggcc
ctgctgtacccgctgcccggctgggtgctgggcgacttcatgtgcaagttcgtcaactac
atccagcaggtctcggtgcaggccacgtgtgccactctgaccgccatgagtgtggaccgc
tggtacgtgacggtgttcccgttgcgcgccctgcaccgccgcacgccccgcctggcgctg
gctgtcagcctcagcatctgggtaggctctgcggcggtgtctgcgccggtgctcgccctg
caccgcctgtcacccgggccgcgcgcctactgcagtgaggccttccccagccgcgccctg
gagcgcgccttcgcactgtacaacctgctggcgctgtacctgctgccgctgctcgccacc
tgcgcctgctatgcggccatgctgcgccacctgggccgggtcgccgtgcgccccgcgccc
gccgatagcgccctgcaggggcaggtgctggcagagcgcgcaggcgccgtgcgggccaag
gtctcgcggctggtggcggccgtggtcctgctcttcgccgcctgctggggccccatccag
ctgttcctggtgctgcaggcgctgggccccgcgggctcctggcacccacgcagctacgcc
gcctacgcgcttaagacctgggctcactgcatgtcctacagcaactccgcgctgaacccg
ctgctctacgccttcctgggctcgcacttccgacaggccttccgccgcgtctgcccctgc
gcgccgcgccgcccccgccgcccccgccggcccggaccctcggaccccgcagccccacac
gcggagctgctccgcctggggtcccacccggcccccgccagggcgcagaagccagggagc
agtgggctggccgcgcgcgggctgtgcgtcctgggggaggacaacgcccctctctga

DBGET integrated database retrieval system