KEGG   Homo sapiens (human): 84636Help
Entry
84636             CDS       T01001                                 

Gene name
GPR174, FKSG79, GPCR17, LYPSR3
Definition
(RefSeq) G protein-coupled receptor 174
  KO
K08391  
G protein-coupled receptor 174
Organism
hsa  Homo sapiens (human)
Brite
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Purine / pyrimidine
    84636 (GPR174)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq21.1
AA seq 333 aa AA seqDB search
MPANYTCTRPDGDNTDFRYFIYAVTYTVILVPGLIGNILALWVFYGYMKETKRAVIFMIN
LAIADLLQVLSLPLRIFYYLNHDWPFGPGLCMFCFYLKYVNMYASIYFLVCISVRRFWFL
MYPFRFHDCKQKYDLYISIAGWLIICLACVLFPLLRTSDDTSGNRTKCFVDLPTRNVNLA
QSVVMMTIGELIGFVTPLLIVLYCTWKTVLSLQDKYPMAQDLGEKQKALKMILTCAGVFL
ICFAPYHFSFPLDFLVKSNEIKSCLARRVILIFHSVALCLASLNSCLDPVIYYFSTNEFR
RRLSRQDLHDSIQLHAKSFVSNHTASTMTPELC
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctaattacacgtgtaccaggccagatggagacaatacagattttcgatacttt
atttatgcagtgacatacactgtcattcttgtgccaggtctcatagggaatatattagcc
ctgtgggtattctatggttatatgaaagaaacaaaacgagctgtgatatttatgataaac
ttagccattgctgacttactacaagttctttccttgccactgaggatcttctactacttg
aatcatgactggccatttgggcctggtctctgcatgttctgtttctacctgaagtatgtc
aacatgtatgcaagcatctacttcttggtctgcatcagtgtgcgacgattttggtttctc
atgtacccctttcgcttccatgactgcaaacagaaatatgacctgtacatcagcattgct
ggctggctgatcatctgccttgcctgtgtactctttccactcctcagaaccagtgatgat
acctctggcaataggaccaaatgctttgtggatcttcctaccaggaatgtcaacctggcc
cagtccgttgttatgatgaccattggcgagttgattgggtttgtaactccgcttctgatt
gtcctatattgtacctggaagacggttttatcactgcaagataaatatcccatggcccaa
gatcttggagagaaacagaaagccttgaagatgattctaacctgtgcaggggtattccta
atttgctttgcaccttatcatttcagttttcctttagatttcctggtgaagtccaatgaa
attaaaagctgcctagccagaagggtgattctaatatttcattctgtggcattgtgtctt
gctagtctgaattcatgtcttgacccagtcatatactacttttccactaatgagttccga
agacggctttcaagacaagatttgcatgacagcatccaactccatgcaaaatcctttgtg
agtaaccatacagcttccaccatgacacctgaattatgctaa

DBGET integrated database retrieval system