KEGG   Homo sapiens (human): 8464Help
Entry
8464              CDS       T01001                                 

Gene name
SUPT3H, SPT3, SPT3L
Definition
(RefSeq) SPT3 homolog, SAGA and STAGA complex component
  KO
K11313  
transcription initiation protein SPT3
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    8464 (SUPT3H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     8464 (SUPT3H)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     8464 (SUPT3H)
    STAGA complex
     8464 (SUPT3H)
    TFTC complex
     8464 (SUPT3H)
    SAGA complex
     8464 (SUPT3H)
    SLIK complex
     8464 (SUPT3H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
O75486(Tbio)
UniProt: 
Position
6p21.1
AA seq 328 aa AA seqDB search
MVVFGTTFFNFDSFIGKTDSIEIIGKSVFPYCYHNILPLLNDSGRYSLGDARRPLHETAV
LVEDVVHTQLINLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSK
IVKGIDEDDLLEDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMER
AERQTRIMDSAQYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETV
AQLVDLALLVRQDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREA
IRRYSHRIGPLSPFTNAYRRNGMAFLAC
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggtggtctttggaacaacgttcttcaactttgacagcttcatagggaaaacagattct
atagaaataattggaaaatcagtttttccctattgttatcacaatatccttccactgctg
aatgattctggcaggtattctttaggtgatgctagaaggcctcttcatgaaacagcagtt
ttggtagaagatgtggtacacactcagttaattaatctgttacagcaagctgctgaagtt
tctcagctgcggggagcaagggtaatcactcctgaagatcttctgtttttgatgcgcaaa
gataagaaaaaacttagaagactgctaaaatacatgtttatccgagactacaaatcaaag
attgtcaaaggcatcgatgaggatgatcttctcgaagacaaattgagtggcagcaataat
gcgaacaaaagacaaaagattgctcaggacttcctcaactctattgaccagacaggagaa
cttttagcaatgtttgaagatgacgaaattgatgaagttaaacaagaaagaatggagaga
gcagaaagacaaactcgaattatggattcagctcaatatgcagaattctgtgaaagtcga
caattaagtttctccaaaaaagcttccaaatttcgagactggttggactgcagcagtatg
gagataaaacccaatgttgtcgcaatggaaatcttagcatatttagcgtatgaaactgtg
gcacagttagtggatctggctcttcttgtgaggcaagacatggtaaccaaggcaggggac
cccttcagccatgccatttctgcaaccttcattcagtatcacaactctgctgagagcact
gcagcctgtggtgttgaggctcacagcgatgccatccagccctgccacatcagagaggcc
attcgacgctacagccacaggattggcccactttccccattcacaaatgcctaccgcagg
aatgggatggcttttctagcctgctga

DBGET integrated database retrieval system