KEGG   Homo sapiens (human): 84649Help
Entry
84649             CDS       T01001                                 

Gene name
DGAT2, ARAT, GS1999FULL
Definition
diacylglycerol O-acyltransferase 2 (EC:2.3.1.20 2.3.1.76)
Orthology
K11160  
diacylglycerol O-acyltransferase 2 [EC:2.3.1.20 2.3.1.75]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Fat digestion and absorption
Module
Triacylglycerol biosynthesis
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Organismal Systems; Digestive system; Fat digestion and absorption [PATH:hsa04975]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.5
AA seq 345 aa AA seqDB search
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGVACSAILMYIFCTDCWLIA
VLYFTWLVFDWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPH
GIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDY
LLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENE
VYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPIT
IPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctcatagccgcctactccggggtcctgcgcggcgagcgtcaggccgaggct
gaccggagccagcgctctcacggaggacctgcgctgtcgcgcgaggggtctgggagatgg
ggagtggcctgcagtgccatcctcatgtacatattctgcactgattgctggctcatcgct
gtgctctacttcacttggctggtgtttgactggaacacacccaagaaaggtggcaggagg
tcacagtgggtccgaaactgggctgtgtggcgctactttcgagactactttcccatccag
ctggtgaagacacacaacctgctgaccaccaggaactatatctttggataccacccccat
ggtatcatgggcctgggtgccttctgcaacttcagcacagaggccacagaagtgagcaag
aagttcccaggcatacggccttacctggctacactggcaggcaacttccgaatgcctgtg
ttgagggagtacctgatgtctggaggtatctgccctgtcagccgggacaccatagactat
ttgctttcaaagaatgggagtggcaatgctatcatcatcgtggtcgggggtgcggctgag
tctctgagctccatgcctggcaagaatgcagtcaccctgcggaaccgcaagggctttgtg
aaactggccctgcgtcatggagctgacctggttcccatctactcctttggagagaatgaa
gtgtacaagcaggtgatcttcgaggagggctcctggggccgatgggtccagaagaagttc
cagaaatacattggtttcgccccatgcatcttccatggtcgaggcctcttctcctccgac
acctgggggctggtgccctactccaagcccatcaccactgttgtgggagagcccatcacc
atccccaagctggagcacccaacccagcaagacatcgacctgtaccacaccatgtacatg
gaggccctggtgaagctcttcgacaagcacaagaccaagttcggcctcccggagactgag
gtcctggaggtgaactga

DBGET integrated database retrieval system