KEGG   Homo sapiens (human): 84649Help
Entry
84649             CDS       T01001                                 

Gene name
DGAT2, ARAT, GS1999FULL, HMFN1045
Definition
(RefSeq) diacylglycerol O-acyltransferase 2
  KO
K11160  
diacylglycerol O-acyltransferase 2 [EC:2.3.1.20 2.3.1.75]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Metabolic pathways
Fat digestion and absorption
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    84649 (DGAT2)
 Organismal Systems
  Digestive system
   04975 Fat digestion and absorption
    84649 (DGAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.20  diacylglycerol O-acyltransferase
     84649 (DGAT2)
    2.3.1.75  long-chain-alcohol O-fatty-acyltransferase
     84649 (DGAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q13.5
AA seq 388 aa AA seqDB search
MKTLIAAYSGVLRGERQAEADRSQRSHGGPALSREGSGRWGTGSSILSALQDLFSVTWLN
RSKVEKQLQVISVLQWVLSFLVLGVACSAILMYIFCTDCWLIAVLYFTWLVFDWNTPKKG
GRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATE
VSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGG
AAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQ
KKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHT
MYMEALVKLFDKHKTKFGLPETEVLEVN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccctcatagccgcctactccggggtcctgcgcggcgagcgtcaggccgaggct
gaccggagccagcgctctcacggaggacctgcgctgtcgcgcgaggggtctgggagatgg
ggcactggatccagcatcctctccgccctccaggacctcttctctgtcacctggctcaat
aggtccaaggtggaaaagcagctacaggtcatctcagtgctccagtgggtcctgtccttc
cttgtactgggagtggcctgcagtgccatcctcatgtacatattctgcactgattgctgg
ctcatcgctgtgctctacttcacttggctggtgtttgactggaacacacccaagaaaggt
ggcaggaggtcacagtgggtccgaaactgggctgtgtggcgctactttcgagactacttt
cccatccagctggtgaagacacacaacctgctgaccaccaggaactatatctttggatac
cacccccatggtatcatgggcctgggtgccttctgcaacttcagcacagaggccacagaa
gtgagcaagaagttcccaggcatacggccttacctggctacactggcaggcaacttccga
atgcctgtgttgagggagtacctgatgtctggaggtatctgccctgtcagccgggacacc
atagactatttgctttcaaagaatgggagtggcaatgctatcatcatcgtggtcgggggt
gcggctgagtctctgagctccatgcctggcaagaatgcagtcaccctgcggaaccgcaag
ggctttgtgaaactggccctgcgtcatggagctgacctggttcccatctactcctttgga
gagaatgaagtgtacaagcaggtgatcttcgaggagggctcctggggccgatgggtccag
aagaagttccagaaatacattggtttcgccccatgcatcttccatggtcgaggcctcttc
tcctccgacacctgggggctggtgccctactccaagcccatcaccactgttgtgggagag
cccatcaccatccccaagctggagcacccaacccagcaagacatcgacctgtaccacacc
atgtacatggaggccctggtgaagctcttcgacaagcacaagaccaagttcggcctcccg
gagactgaggtcctggaggtgaactga

DBGET integrated database retrieval system