KEGG   Homo sapiens (human): 84667Help
Entry
84667             CDS       T01001                                 

Gene name
HES7, SCDO4, bHLHb37
Definition
hes family bHLH transcription factor 7
Orthology
K09087  
hairy and enhancer of split 2/6/7
Organism
hsa  Homo sapiens (human)
Disease
H00517  
Spondylocostal dysostosis (SCD)
Brite
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    84667 (HES7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.1
AA seq 230 aa AA seqDB search
MVTRDRAENRDGPKMLKPLVEKRRRDRINRSLEELRLLLLERTRDQNLRNPKLEKAEILE
FAVGYLRERSRVEPPAAAAPGVPRSPVQDAEALASCYLSGFRECLLRLAAFAHDASPAAR
AQLFSALHGYLRPKPPRPKPVDPRPPAPRPSLDPAAPALGPALHQRPPVHQGHPSPRCAW
SPSLCSPRAGDSGAPAPLTGLLPPPPPPHRQDGAPKAPLPPPPAFWRPWP
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggtcacccgggatcgagctgagaatagggacggccccaagatgctcaagccgcttgtg
gagaagcggcgccgggaccgcatcaaccgcagcctggaagagctgaggctgctgctgctg
gagcggacccgggaccagaacctccggaacccgaagctggagaaagcggagatattggag
ttcgccgtgggctacttgagggagcgaagccgggtggagcccccggccgccgcggctcca
ggggttccccggtccccagtccaggacgccgaggcgctcgccagctgctacttgtccggt
ttccgcgagtgcctgcttcgcttggcggccttcgcgcacgacgccagcccggccgcccgc
gcccagctcttctccgcgctgcacggctatctgcgccccaaaccgccccggcccaagccg
gtagatccgaggcctccagcgccgcgcccatccctggaccccgccgcaccggcccttggc
cctgcgctgcaccagcgccccccagtgcaccagggccaccctagcccgcgctgcgcatgg
tccccatccctctgctccccgcgcgccggggattctggcgcgccggcgcccctcaccgga
ctgctgccgccgccaccgccgcctcacagacaagacggggcgcccaaggccccgctgccc
ccgccgcccgctttctggagaccttggccctga

DBGET integrated database retrieval system