KEGG   Homo sapiens (human): 84674Help
Entry
84674             CDS       T01001                                 

Gene name
CARD6, CINCIN1
Definition
caspase recruitment domain family, member 6
Orthology
K12797  
caspase recruitment domain-containing protein 6
Organism
hsa  Homo sapiens (human)
Pathway
NOD-like receptor signaling pathway
Class
Organismal Systems; Immune system; NOD-like receptor signaling pathway [PATH:hsa04621]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5p13.1
AA seq 1037 aa AA seqDB search
MATESTPSEIIERERKKLLEILQHDPDSILDTLTSRRLISEEEYETLENVTDLLKKSRKL
LILVQKKGEATCQHFLKCLFSTFPQSAAICGLRHEVLKHENTVPPQSMGASSNSEDAFSP
GIKQPEAPEITVFFSEKEHLDLETSEFFRDKKTSYRETALSARKNEKEYDTPEVTLSYSV
EKVGCEVPATITYIKDGQRYEELDDSLYLGKEEYLGSVDTPEDAEATVEEEVYDDPEHVG
YDGEEDFENSETTEFSGEEPSYEGSETSLSLEEEQEKSIEERKKVFKDVLLCLNMDRSRK
VLPDFVKQFSLDRGCKWTPESPGDLAWNFLMKVQARDVTARDSILSHKVLDEDSKEDLLA
GVENLEIRDIQTINPLDVLCATMLCSDSSLQRQVMSNMYQCQFALPLLLPDAENNKSILM
LGAMKDIVKKQSTQFSGGPTEDTEKFLTLMKMPVISFVRLGYCSFSKSRILNTLLSPAQL
KLHKIFLHQDLPLLVLPRQISDGLVEITWCFPDSDDRKENPFFQKPVALANLRGNLESFW
TQFGFLMEVSSAVFFFTDCLGEKEWDLLMFLGEAAIERCYFVLSSQARESEEAQIFQRIL
NLKPAQLLFWERGDAGDRRKNMEGLQAALQEVMFSSCLRCVSVEDMAALARELGIQVDED
FENTQRIQVSSGENMAGTAEGEGQQRHSQLKSSSKSQALMPIQEPGTQCELSQNLQNLYG
TPVFRPVLENSWLFPTRIGGNFNHVSLKASWVMGRPFGSEQRPKWFHPLPFQNAGAQGRG
KSFGIQSFHPQIFYSGERFMKFSRVARGCHSNGTFGRLPRPICQHVQACPERPQMMGTLE
RSRAVASKIGHSYSLDSQPARAVGKPWPQQACTRVTELTEATGKLIRTSHIGKPHPQSFQ
PAAATQKLRPASQQGVQMKTQGGASNPALQIGSHPMCKSSQFKSDQSNPSTVKHSQPKPF
HSVPSQPKSSQTKSCQSQPSQTKPSPCKSTQPKPSQPWPPQSKPSQPRPPQPKSSSTNPS
QAKAHHSKAGQKRGGKH
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgagagtactccctcagagatcatagaaagagaaagaaaaaagttgcttgaa
atccttcaacatgatcctgattctatcttagacacgttaacttctcggaggctgatttct
gaggaagagtatgagactctggagaatgttacagatctcctgaagaaaagtcggaagctg
ttaattttggtacagaaaaagggagaggcgacctgtcagcattttctcaagtgtttattt
agtacttttccacagtcagctgccatttgcggcttaaggcatgaagttttaaaacatgag
aatacagtacctcctcaatctatgggggcaagcagtaattcagaagatgctttttctcct
ggaataaaacagcctgaagcccctgagatcacagtgttcttcagtgagaaggaacacttg
gatttggaaacctctgagtttttcagggacaagaaaactagttatagggaaacagctttg
tctgccaggaagaatgagaaggaatatgacacaccagaagtcacattatcatattcagtt
gagaaagttggatgtgaagttccagcaactattacatatataaaagatggacagagatat
gaggagctagatgattctttatacttaggaaaagaggaatatctaggatctgttgacacc
cctgaagatgcagaagccactgtggaagaggaggtttatgatgacccagagcacgttgga
tatgatggtgaagaggacttcgagaattcagaaaccacagagttctctggtgaagaacca
agttatgagggatcagaaaccagcctttcattggaggaggaacaggagaaaagtatagaa
gaaagaaaaaaggtgtttaaagatgtcctgttatgtttgaacatggatagaagcagaaag
gttctgccagattttgttaaacaattctccttagatcgaggatgtaagtggacccctgag
agtccaggagacttagcctggaatttcctgatgaaagttcaagcacgagatgtgacggct
agggattcaatcctcagtcacaaggttctggatgaagatagcaaggaggatttgctggct
ggagtggagaatttggaaattcgagacatacaaaccattaatccccttgacgtgctttgt
gccaccatgctgtgttcagatagctctttgcaacgccaagtcatgtcaaacatgtatcag
tgccagtttgctcttcccctgctactgccagatgcagaaaacaacaaaagcatcttaatg
ctgggggccatgaaagacattgtgaagaagcagtcaacacagttttcaggggggcctaca
gaggatacagaaaagtttctgactctcatgaagatgcctgtcatctcttttgtgcgtcta
ggatactgtagcttctctaagtccagaatcctcaacacacttctcagccctgcccagttg
aaattacacaaaatctttcttcatcaagatttgcctcttttggtgcttccccggcaaatc
tctgatggcctggttgagataacatggtgttttcctgatagcgatgatagaaaggaaaac
ccctttttccaaaagcctgttgctctggctaatctccgtggaaatctagaaagcttttgg
actcagtttggttttttgatggaagtttcttcagctgtgttttttttcactgactgttta
ggtgagaaggaatgggacttgctaatgtttttaggagaggctgccattgaaagatgctac
tttgttctcagttcccaagccagggagagtgaagaggctcaaatttttcagaggatactg
aacttgaagccagcacagctactgttttgggagaggggagatgctggggatagaaggaag
aacatggagggccttcaagctgccctccaggaagtgatgttctcttcttgcctcagatgt
gtgtctgtggaggatatggccgccctggccagggagctggggattcaggtagatgaagac
tttgaaaacactcagagaattcaagtttcctctggagaaaacatggctgggacagctgaa
ggtgagggtcagcaaagacacagtcagctaaaaagctcatctaaaagccaggctctaatg
ccaattcaagagcctgggactcaatgtgagctcagccagaatcttcagaatctctatggt
accccagtattcaggcctgttctagagaactcctggctctttccaaccagaattggaggt
aactttaaccatgtttccttgaaagcctcctgggttatgggccgcccctttgggtcagag
cagaggcctaagtggttccatcctttgccttttcagaatgcaggggcccagggccgaggt
aaaagttttggtattcaatccttccatccccagatattttattcaggtgaaagattcatg
aaattttccagagttgctcggggatgtcactcgaatggaacatttgggagactgccaaga
cccatttgtcagcatgtacaggcctgccctgagagaccacaaatgatgggaactcttgaa
aggtctagggcagtagcctccaagataggtcactcctattccctggattcacagccagca
agagcagtagggaagccatggcctcagcaagcttgcaccagggtaacagagttaactgaa
gcaactggaaaactgataagaacatcccatattggaaagcctcaccctcagtcctttcaa
ccagcagcagccacacaaaaactaagacctgcttctcagcaaggagtccagatgaagaca
caaggtggggcttcaaatccagctctccaaatagggtcccatcccatgtgcaagagctct
cagttcaaatccgatcagtccaacccatccacagtcaaacactcccagcctaaacccttc
cattctgtgccctctcaacctaaatcctctcagacaaaatcctgtcagtcccagccctcc
caaactaaaccttctccatgcaaatctactcagcctaagccaagccagccctggcctccc
cagtctaagccttctcagcccagaccccctcaacctaagtcatcctcaaccaatccttca
caagctaaggcacaccactcaaaagcagggcagaagaggggagggaagcattaa

DBGET integrated database retrieval system