KEGG   Homo sapiens (human): 84687Help
Entry
84687             CDS       T01001                                 

Gene name
PPP1R9B, PPP1R6, PPP1R9, SPINO, Spn
Definition
(RefSeq) protein phosphatase 1 regulatory subunit 9B
  KO
K17551  
neurabin
Organism
hsa  Homo sapiens (human)
Brite
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     84687 (PPP1R9B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     84687 (PPP1R9B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q21.33
AA seq 817 aa AA seqDB search
MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKGAHHKKYGSNVHRIKSM
FLQMGTTAGPSGEAGGGAGLAEAPRASERGVRLSLPRASSLNENVDHSALLKLGTSVSER
VSRFDSKPAPSAQPAPPPHPPSRLQETRKLFERSAPAAAGGDKEAAARRLLRQERAGLQD
RKLDVVVRFNGSTEALDKLDADAVSPTVSQLSAVFEKADSRTGLHRGPGLPRAAGVPQVN
SKLVSKRSRVFQPPPPPPPAPSGDAPAEKERCPAGQQPPQHRVAPARPPPKPREVRKIKP
VEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAPEKEAAAVA
PPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEDDEDDEED
GEPPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFSTYSNEDYDRRNEDVDPMAAS
AEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRD
GRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLE
QERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFPGGEMAIEVFELAENEDALSPV
DMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKGRWRVEKAQLEQSVEENKERM
EKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQR
RVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagacggagccacgggggcccgggggtcccctccggagcgcctccccgcaccgc
agcgcctacgaggcgggcatccaggcgctgaagccgcccgacgcgcccgggcccgacgag
gcacccaagggggcccaccacaagaaatatggctccaacgtccaccgcatcaaaagtatg
ttcctgcagatgggcacgacggcggggccctcgggcgaggcgggcggcggcgcgggcctg
gccgaggccccacgggcgtccgagcgcggcgtgcgcctgtcgctgccgcgggccagcagc
ctgaacgagaacgtggaccacagcgccctgctgaagctgggcaccagcgtgtcggagcgc
gtgagccgcttcgactccaagcccgcgccctccgcgcagcctgcgccgccgccgcacccg
ccgtcccggctgcaggagacgcggaagctgttcgaacggagcgccccagcggccgcaggc
ggcgacaaggaggccgcggcgcggcggctgctgaggcaggagcgcgccggcctgcaggac
cggaagctggacgtcgtggtgcgcttcaacggcagcaccgaggcgctggacaagctggac
gctgacgccgtgtcccccacggtcagccagctcagcgccgtcttcgagaaggccgactcg
aggaccggcctccaccgcgggcccgggctccccagggccgcaggggttccccaggtcaac
tcgaagctggtcagcaagcggtcccgggtgttccagcccccgccgccgccgccgcccgcc
ccgtcgggggatgccccggccgagaaagagcgatgccccgcagggcagcagcccccgcag
caccgagtggcccctgcccggccgccccccaagccccgggaggtgcgcaagattaagccg
gtggaggtggaggagagcggggagtcggaggccgagtcggcgcccggggaggtgatccag
gccgaggttacggtccacgcggccctggagaatggcagcaccgtggcaactgcagccagc
cccgcgcccgaggagccaaaggcccaagcggccccggagaaggaggcggcggcggtagcg
ccgccagagaggggggtgggcaatggccgggccccggacgtggcccctgaggaggtagat
gaatccaagaaggaggacttctcggaggcggacttggtggacgtgagcgcctacagtggg
ctcggggaggactctgcgggcagtgccctggaggaggacgacgaagacgacgaggaggat
ggggagcccccctacgagcccgagtcggggtgcgtggagatcccggggctgtcggaggag
gaggacccagccccgagccggaagatccatttcagcacggcgcccatccaagtgttcagc
acttactccaacgaggattacgatcgtcgcaacgaggatgtggatcccatggcagcctct
gctgagtacgagctggagaagcgtgtggagaggttggagctgttccctgtggagctggag
aaggactccgagggcctgggcatcagcatcatcggcatgggcgccggggcagacatgggc
ctggagaagctgggtatcttcgtcaagaccgtgacggagggtggtgcggcccatcgggat
ggcaggatccaggtgaatgatctcctggtggaggtggatggaacaagtctggtgggagtg
acccagagcttcgcggcgtctgtgctccggaacaccaagggccgagtgcggtttatgatt
ggccgggagcggccgggagagcagagcgaagtggcccagctaattcagcagactttggaa
caggagcgatggcagcgggagatgatggagcagagatacgcccagtatggggaggatgac
gaggagacgggagagtatgccactgacgaggatgaggagctgagccccacgttcccgggt
ggtgagatggccatcgaggtgtttgagctagcggagaacgaggatgcactgtcccctgtg
gacatggagcccgagaagctggtgcacaagttcaaggagctccagatcaagcatgcggtc
actgaggcagagatccagcagctgaaaagaaagctgcagagcctggagcaggagaagggg
cgctggcgggtggagaaggcgcagttggagcagagtgtggaggagaacaaggagcgcatg
gagaaactggaaggctactggggtgaggcccagagcctgtgccaggctgtggacgagcac
ctgcgggagactcaggcgcagtaccaggccctggagcgcaagtacagcaaggccaagcgc
ctcatcaaggactaccagcagaaggagatcgagttcctgaaaaaggagactgcacagcgt
cgggttctggaggagtcggagctggccagaaaggaggagatggacaagctcctggacaag
atctcagaactggaaggaaacttgcaaacactgaggaattccaattctacttaa

DBGET integrated database retrieval system