KEGG   Homo sapiens (human): 84693Help
Entry
84693             CDS       T01001                                 

Gene name
MCEE, GLOD2
Definition
methylmalonyl CoA epimerase (EC:5.1.99.1)
Orthology
K05606  
methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Disease
H00174  
Methylmalonic aciduria (MMA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    84693 (MCEE)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    84693 (MCEE)
   00640 Propanoate metabolism
    84693 (MCEE)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    84693 (MCEE)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     84693 (MCEE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p13.3
AA seq 176 aa AA seqDB search
MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEK
AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM
HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggtgctgaaggctgcagccgcgaatgccgtagggcttttttccagacttcaa
gctcccattccaacagtaagagcttcttccacatcacagcccttggatcaagtgacaggt
tctgtgtggaacctgggtcgactcaaccatgtagccatagcagtgccagatttggaaaag
gctgcagcattttataagaatattctgggggcccaggtaagtgaagcggtccctcttcct
gaacatggagtatctgttgtttttgtcaacctgggaaataccaagatggaactgcttcat
ccattgggacgtgacagtccaattgcaggttttctgcagaaaaacaaggctggaggaatg
catcacatctgcatcgaggtggataatattaatgcagctgtgatggatttgaaaaaaaag
aagatccgcagtctaagtgaagaggtcaaaataggagcacatggaaaaccagtgattttt
ctccatcctaaagactgtggtggagtccttgtggaactggagcaagcttga

DBGET integrated database retrieval system