KEGG   Homo sapiens (human): 84693Help
Entry
84693             CDS       T01001                                 

Gene name
MCEE, GLOD2
Definition
(RefSeq) methylmalonyl-CoA epimerase
  KO
K05606  
methylmalonyl-CoA/ethylmalonyl-CoA epimerase [EC:5.1.99.1]
Organism
hsa  Homo sapiens (human)
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Module
Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Disease
H00174  
Methylmalonic aciduria (MMA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    84693 (MCEE)
   00640 Propanoate metabolism
    84693 (MCEE)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    84693 (MCEE)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.99  Acting on other compounds
    5.1.99.1  methylmalonyl-CoA epimerase
     84693 (MCEE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96PE7(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
2p13.3
AA seq 176 aa AA seqDB search
MARVLKAAAANAVGLFSRLQAPIPTVRASSTSQPLDQVTGSVWNLGRLNHVAIAVPDLEK
AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM
HHICIEVDNINAAVMDLKKKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggtgctgaaggctgcagccgcgaatgccgtagggcttttttccagacttcaa
gctcccattccaacagtaagagcttcttccacatcacagcccttggatcaagtgacaggt
tctgtgtggaacctgggtcgactcaaccatgtagccatagcagtgccagatttggaaaag
gctgcagcattttataagaatattctgggggcccaggtaagtgaagcggtccctcttcct
gaacatggagtatctgttgtttttgtcaacctgggaaataccaagatggaactgcttcat
ccattgggacgtgacagtccaattgcaggttttctgcagaaaaacaaggctggaggaatg
catcacatctgcatcgaggtggataatattaatgcagctgtgatggatttgaaaaaaaag
aagatccgcagtctaagtgaagaggtcaaaataggagcacatggaaaaccagtgattttt
ctccatcctaaagactgtggtggagtccttgtggaactggagcaagcttga

DBGET integrated database retrieval system