KEGG   Homo sapiens (human): 84699Help
Entry
84699             CDS       T01001                                 

Gene name
CREB3L3, CREB-H, CREBH, HYST1481
Definition
(RefSeq) cAMP responsive element binding protein 3 like 3
  KO
K09048  
cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Glucagon signaling pathway
Aldosterone synthesis and secretion
Insulin resistance
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    84699 (CREB3L3)
   04024 cAMP signaling pathway
    84699 (CREB3L3)
   04022 cGMP - PKG signaling pathway
    84699 (CREB3L3)
   04151 PI3K-Akt signaling pathway
    84699 (CREB3L3)
   04152 AMPK signaling pathway
    84699 (CREB3L3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    84699 (CREB3L3)
   04922 Glucagon signaling pathway
    84699 (CREB3L3)
   04915 Estrogen signaling pathway
    84699 (CREB3L3)
   04918 Thyroid hormone synthesis
    84699 (CREB3L3)
   04916 Melanogenesis
    84699 (CREB3L3)
   04925 Aldosterone synthesis and secretion
    84699 (CREB3L3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    84699 (CREB3L3)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    84699 (CREB3L3)
  Nervous system
   04725 Cholinergic synapse
    84699 (CREB3L3)
   04728 Dopaminergic synapse
    84699 (CREB3L3)
  Aging
   04211 Longevity regulating pathway - mammal
    84699 (CREB3L3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    84699 (CREB3L3)
   05215 Prostate cancer
    84699 (CREB3L3)
  Neurodegenerative diseases
   05016 Huntington's disease
    84699 (CREB3L3)
  Substance dependence
   05030 Cocaine addiction
    84699 (CREB3L3)
   05031 Amphetamine addiction
    84699 (CREB3L3)
   05034 Alcoholism
    84699 (CREB3L3)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    84699 (CREB3L3)
  Infectious diseases
   05161 Hepatitis B
    84699 (CREB3L3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    84699 (CREB3L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 461 aa AA seqDB search
MNTDLAAGKMASAACSMDPIDSFELLDLLFDRQDGILRHVELGEGWGHVKDQQVLPNPDS
DDFLSSILGSGDSLPSSPLWSPEGSDSGISEDLPSDPQDTPPRSGPATSPAGCHPAQPGK
GPCLSYHPGNSCSTTTPGPVIQVPEASVTIDLEMWSPGGRICAEKPADPVDLSPRCNLTV
KDLLLSGSSGDLQQHHLGASYLLRPGAGHCQELVLTEDEKKLLAKEGITLPTQLPLTKYE
ERVLKKIRRKIRNKQSAQESRKKKKEYIDGLETRMSACTAQNQELQRKVLHLEKQNLSLL
EQLKKLQAIVVQSTSKSAQTGTCVAVLLLSFALIILPSISPFGPNKTESPGDFAPVRVFS
RTLHNDAASRVAADAVPGSEAPGPRPEADTTREESPGSPGADWGFQDTANLTNSTEELDN
ATLVLRNATEGLGQVALLDWVAPGPSTGSGRAGLEAAGDEL
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaatacggatttagctgctggaaagatggcttctgctgcctgctccatggaccccatc
gacagctttgagctcctggatctcctgtttgaccggcaggacggcatcctgagacacgtg
gagctgggcgagggctggggtcacgtcaaggaccagcaggtcctgccaaaccccgactct
gacgacttcctcagctccatcctgggctctggagactcactgcccagctccccactctgg
tcccccgaaggcagtgatagtggcatctccgaagacctcccctccgacccccaggacacc
cctccacgcagcggaccagccacctcccccgccggctgccatcctgcccagcctggcaag
gggccctgcctctcctatcatcctggcaactcttgctccaccacaaccccagggccagtg
atccaagtacctgaagcctctgtgaccatagacctggaaatgtggagcccaggaggaagg
atctgtgctgagaagccggctgatccggtggacctgtccccacgatgcaatctcaccgtg
aaagacctcctcctttcgggcagcagtggggacctgcaacagcatcacctgggggcctcc
tacctcctgcgacctggggctgggcactgtcaggagctggtgctcaccgaggatgagaag
aagctgctggctaaagaaggcatcaccctgcccactcagctgcccctcactaagtacgag
gagcgagtgctgaaaaaaatccgccggaaaatccggaacaagcagtcggcgcaagaaagc
aggaagaagaagaaggaatatatcgatggcctggagactcggatgtcagcttgcactgct
cagaatcaggagttacagaggaaagtcttgcatctcgagaagcaaaacctgtccctcttg
gagcaactgaagaaactccaggccattgtggtgcagtccaccagcaagtcagcccagaca
ggcacctgtgtcgcagtcctgttgctgtcctttgccctcatcatcctcccctccatcagc
ccttttggccccaacaaaaccgagagccctggggactttgcgcctgtacgagtgttctcc
agaactttgcacaacgatgctgcctcccgcgtggctgctgatgctgtgccaggctccgag
gccccaggaccccgacccgaggctgacacaacccgagaagagtctccaggaagccccggg
gcagactggggcttccaggacaccgcgaacctgaccaattcgacggaggagctggacaac
gccaccctggtcctgaggaatgcaacagaggggctgggccaggtcgccctgctggactgg
gtggcgcctgggccgagcactggctcaggacgtgcagggctggaggcggcgggagacgag
ctgtga

DBGET integrated database retrieval system