KEGG   Homo sapiens (human): 8470Help
Entry
8470              CDS       T01001                                 

Gene name
SORBS2, ARGBP2, PRO0618
Definition
(RefSeq) sorbin and SH3 domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q35.1
AA seq 1100 aa AA seqDB search
MSYYQRPFSPSAYSLPASLNSSIVMQHGTSLDSTDTYPQHAQSLDGTTSSSIPLYRSSEE
EKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRPKDWYKTMFKQIHMVHKPDDDTDMYNT
PYTYNAGLYNPPYSAQSHPAAKTQTYRPLSKSHSDNSPNAFKDASSPVPPPHVPPPVPPL
RPRDRSSTEKHDWDPPDRKVDTRKFRSEPRSIFEYEPGKSSILQHERPASLYQSSIDRSL
ERPMSSASMASDFRKRRKSEPAVGPPRGLGDQSASRTSPGRVDLPGSSTTLTKSFTSSSP
SSPSRAKGGDDSKICPSLCSYSGLNGNPSSELDYCSTYRQHLDVPRDSPRAISFKNGWQM
ARQNAEIWSSTEETVSPKIKSRSCDDLLNDDCDSFPDPKVKSESMGSLLCEEDSKESCPM
AWGSPYVPEVRSNGRSRIRHRSARNAPGFLKMYKKMHRINRKDLMNSEVICSVKSRILQY
ESEQQHKDLLRAWSQCSTEEVPRDMVPTRISEFEKLIQKSKSMPNLGDDMLSPVTLEPPQ
NGLCPKRRFSIEYLLEEENQSGPPARGRRGCQSNALVPIHIEVTSDEQPRAHVEFSDSDQ
DGVVSDHSDYIHLEGSSFCSESDFDHFSFTSSESFYGSSHHHHHHHHHHHRHLISSCKGR
CPASYTRFTTMLKHERARHENTEEPRRQEMDPGLSKLAFLVSPVPFRRKKNSAPKKQTEK
AKCKASVFEALDSALKDICDQIKAEKKRGSLPDNSILHRLISELLPDVPERNSSLRALRR
SPLHQPLHPLPPDGAIHCPPYQNDCGRMPRSASFQDVDTANSSCHHQDRGGALQDRESPR
SYSSTLTDMGRSAPRERRGTPEKEKLPAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNW
YEGEHHGRVGIFPISYVEKLTPPEKAQPARPPPPAQPGEIGEAIAKYNFNADTNVELSLR
KGDRVILLKRVDQNWYEGKIPGTNRQGIFPVSYVEVVKKNTKGAEDYPDPPIPHSYSSDR
IHSLSSNKPQRPVFTHENIQGGGEPFQALYNYTPRNEDELELRESDVIDVMEKCDDGWFV
GTSRRTKFFGTFPGNYVKRL
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgagttactatcagaggccgttttccccctcggcatattctctcccagcctcactcaac
tccagcattgtcatgcagcacggcacatccctcgattccacagacacatatccccagcat
gcgcagtctctggatggcaccaccagcagctctatccccctgtaccgatcctcagaggaa
gagaagagagtgacagtcatcaaagccccgcattacccagggatcgggcccgtggatgaa
tccggaatccccacagcaattagaacgacagtcgaccggcccaaggactggtacaagacg
atgtttaagcaaattcacatggtgcacaagccggatgatgacacagacatgtataatact
ccttatacatacaatgcaggtctgtacaacccaccctacagtgctcagtcacaccctgct
gcaaagacccaaacctacagacctctttccaaaagccactccgacaacagccccaatgcc
tttaaggatgcgtcctccccagtgcctcccccacatgttccacctccagtcccgccgctt
cgaccaagagatcggtcttcaacagaaaagcatgactgggatcctccagacagaaaagtg
gacacaagaaaatttcggtctgagccaaggagtatttttgaatatgaacctggcaagtca
tcaattcttcagcatgaaagaccagcctccttgtatcagtcctctatagacagaagcctg
gaaagacccatgagttctgcaagcatggccagtgacttcaggaagcggaggaagagcgag
cctgcagtgggtccaccacggggcttgggagatcaaagtgcgagcaggactagcccaggc
cgagtggacctcccaggatcaagcaccactcttacaaagtctttcactagctcttctcct
tcttccccatcaagagcaaaaggtggggatgatagcaaaatatgtccatccctttgcagt
tactcagggctcaacggcaacccctccagtgagttagattactgtagcacttacagacag
cacttggatgtccctcgggactcaccaagagccattagtttcaagaacggctggcaaatg
gcccggcaaaacgcagaaatctggagcagcacggaagaaaccgtctctcccaaaatcaaa
tcccggagctgtgacgatctcctaaacgacgactgcgatagcttcccggacccgaaagtc
aagtcggaaagcatgggctccctgttatgtgaggaggactccaaggagagctgccccatg
gcgtgggggtccccctacgtcccggaggttcgcagtaacggcagatcaaggatcagacac
aggtcagcccgcaacgccccggggttcctgaagatgtacaagaaaatgcaccgcatcaac
cgcaaggacctgatgaactccgaggtgatctgctccgtgaagtccaggattctgcagtac
gagagcgagcagcagcacaaggacctgctgcgcgcctggagccagtgctccacggaggag
gtgccccgggacatggtgcccacacgcatctccgaattcgaaaagctgatccagaagtcc
aaatccatgccaaatttaggggatgacatgctgtctcccgtaaccctagaaccaccgcaa
aatggcctatgtcccaagaggcggttttccattgagtatttgctggaggaagaaaatcaa
agcggcccccccgctcggggccggcgaggctgccagtctaacgccctggtgcccattcac
attgaagtcaccagcgatgagcagccccgagcacacgtggagttttccgacagcgaccag
gacggggttgtgtccgaccacagtgactacattcacctagaggggtcatccttctgcagt
gaaagtgactttgatcacttttccttcacatcctccgaaagcttttacggatccagccac
caccaccaccatcaccaccaccaccaccaccgccacctcatcagctcctgcaaaggcagg
tgcccggcctcctacactcgatttaccacaatgttaaaacacgaaagagccagacacgaa
aacaccgaggagcccagaaggcaagaaatggaccctggcctttctaaacttgcttttcta
gtcagtcctgtgcctttccggaggaaaaaaaattcggctcctaagaaacagactgaaaag
gcaaaatgtaaagcatctgtgtttgaggctctggactctgcccttaaagacatctgtgac
caaattaaagctgaaaagaaaagggggagcttgccggacaacagcatcctgcaccgcctc
atcagtgagctgctgccagatgttcccgagaggaactcatccctgagagcgctgaggagg
agccccctgcaccagcctctccacccactgcctcccgatggtgctattcattgtccaccc
taccagaatgactgcgggagaatgccccgcagtgcctctttccaagacgtggacacagcc
aacagcagctgccaccaccaagaccgtggcggtgcactccaagaccgtgagtcccctaga
agttactcatccactttgactgacatggggagaagtgcaccaagggaaagaagaggaact
ccagaaaaagagaaattgcctgcaaaagctgtttatgattttaaggctcagacatctaag
gagttgtcatttaagaaaggagatactgtctacatcctcaggaaaattgatcaaaattgg
tatgagggagaacaccacgggagagtgggcatcttcccgatctcatacgtagagaaactc
acacctcctgagaaagcacagcctgcaagaccacctccgccagcccagcccggagaaatc
ggagaagctatagccaaatacaacttcaacgcagacacaaatgtggagctgtcactgaga
aagggagatagagttattcttcttaaaagagttgatcaaaactggtatgaaggtaaaatc
ccaggaaccaacagacaaggcatcttccctgtttcctatgtggaggtcgtcaagaagaac
acaaaaggtgctgaggactaccctgaccctccaataccccacagctattctagtgatagg
attcacagcttgagctcaaataagccacagcgtcctgtgtttactcatgaaaatattcaa
ggtgggggggaaccgtttcaggctctgtataactatactcccaggaatgaagatgagctg
gagctcagagaaagtgatgtcattgatgtcatggaaaagtgtgatgacggctggtttgtg
gggacctcaagaagaaccaaattctttggtactttccccggaaactacgtcaagaggctg
tga

DBGET integrated database retrieval system