KEGG   Homo sapiens (human): 8471Help
Entry
8471              CDS       T01001                                 

Gene name
IRS4, IRS-4, PY160
Definition
insulin receptor substrate 4
Orthology
K17446  
insulin receptor substrate 4
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
FoxO signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Type II diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    8471 (IRS4)
   04022 cGMP - PKG signaling pathway
    8471 (IRS4)
   04152 AMPK signaling pathway
    8471 (IRS4)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    8471 (IRS4)
   04920 Adipocytokine signaling pathway
    8471 (IRS4)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    8471 (IRS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq22.3
AA seq 1257 aa AA seqDB search
MASCSFTRDQATRRLRGAAAAAAAALAAVVTTPLLSSGTPTALIGTGSSCPGAMWLSTAT
GSRSDSESEEEDLPVGEEVCKRGYLRKQKHGHRRYFVLKLETADAPARLEYYENARKFRH
SVRAAAAAAAAAASGAAIPPLIPPRRVITLYQCFSVSQRADARYRHLIALFTQDEYFAMV
AENESEQESWYLLLSRLILESKRRRCGTLGAQPDGEPAALAAAAAAEPPFYKDVWQVIVK
PRGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRCGHSEQYFFLEVGRST
VIGPGELWMQVDDCVVAQNMHELFLEKMRALCADEYRARCRSYSISIGAHLLTLLSARRH
LGLVPLEPGGWLRRSRFEQFCHLRAIGDGEDEMLFTRRFVTPSEPVAHSRRGRLHLPRGR
RSRRAVSVPASFFRRLAPSPARPRHPAEAPNNGARLSSEVSGSGSGNFGEEGNPQGKEDQ
EGSGGDYMPMNNWGSGNGRGSGGGQGSNGQGSSSHSSGGNQCSGEGQGSRGGQGSNGQGS
GGNQCSRDGQGTAGGHGSGGGQRPGGGHGSGGGQGPGDGHGSGGGKNSGGGKGSGSGKGS
DGDGERGKSLKKRSYFGKLTQSKQQQMPPPPPPPPPPPPAGGTGGKGKSGGRFRLYFCVD
RGATKECKEAKEVKDAEIPEGAARGPHRARAFDEDEDDPYVPMRPGVATPLVSSSDYMPM
APQNVSASKKRHSRSPFEDSRGYMMMFPRVSPPPAPSPPKAPDTNKEDDSKDNDSESDYM
FMAPGAGAIPKNPRNPQGGSSSKSWSSYFSLPNPFRSSPLGQNDNSEYVPMLPGKFLGRG
LDKEVSYNWDPKDAASKPSGEGSFSKPGDGGSPSKPSDHEPPKNKAKRPNRLSFITKGYK
IKPKPQKPTHEQREADSSSDYVNMDFTKRESNTPAPSTQGLPDSWGIIAEPRQSAFSNYV
NVEFGVPFPNPANDLSDLLRAIPRANPLSLDSARWPLPPLPLSATGSNAIEEEGDYIEVI
FNSAMTPAMALADSAIRYDAETGRIYVVDPFSECCMDISLSPSRCSEPPPVARLLQEEEQ
ERRRPQSRSQSFFAAARAAVSAFPTDSLERDLSPSSAPAVASAAEPTLALSQVVAAASAL
AAAPGIGAAAAAAGFDSASARWFQPVANAADAEAVRGAQDVAGGSNPGAHNPSANLARGD
NQAGGAAAAAAAPEPPPRSRRVPRPPEREDSDNDDDTHVRMDFARRDNQFDSPKRGR
NT seq 3774 nt NT seq  +upstreamnt  +downstreamnt
atggcgagttgctccttcactcgcgaccaagcgacaagaagactaagaggtgcagcagcg
gcggcagcggcagctctagcagcagtggtgaccaccccgcttctttcctcgggaaccccg
accgcactcattgggaccgggtcgtcttgtccgggagccatgtggctctccacggccact
ggctcccggtcagactccgagtccgaagaggaggacctgcccgtcggggaggaagtctgc
aaacgcggctacctgcggaaacagaagcatgggcacaggcgctacttcgtgctcaaactc
gagactgctgacgccccagctcggctggaatactacgaaaatgccaggaagttccggcac
agtgtccgcgccgcggcggctgcagcagcggcggccgcctctggcgccgcgatccccccg
ctcattccaccgcggcgcgtgatcaccctataccagtgcttttccgtgagccagcgagca
gatgcaaggtaccgacacctcattgctcttttcacccaagacgaatacttcgcgatggtg
gccgagaacgagtcggagcaggaaagctggtacttgctgctcagccgcctcatcctcgag
agcaagcgccgccgctgcggcacgctcggcgcgcagccggacggagagccggccgcgctg
gcggcggcagcggcggcggagccacccttctataaagatgtgtggcaggtaatagtcaaa
cccagggggctggggcacagaaaagagctgagcggcgtgttccggctgtgtctaaccgac
gaggaggtcgtgtttgtgaggctgaacaccgaagtggccagcgtggtcgtccagctcctg
agcatccgtcgctgtggacactcggagcagtatttcttcttggaagtaggcaggtccact
gtcatcggtccgggagagctctggatgcaggtcgatgactgtgtggttgcccaaaacatg
catgagctgtttttggagaagatgagagccttgtgtgcagacgaatacagagcccgctgc
cgcagctacagcatcagcatcggcgcccacctgttaaccctgctgtccgctaggaggcac
ctgggcttggtgccgctcgagccgggaggctggctcagaaggtcccgctttgagcagttt
tgccacctcagggccatcggcgacggggaagacgagatgcttttcaccaggcgcttcgta
acacccagcgagcctgtggcccactccaggcgaggaagactgcacctgcccagagggcgc
aggtcaaggagagcggtttcagtgccggccagcttttttcgccgcttagcacccagccca
gcacgtccccggcaccctgcagaagccccgaacaatggagctcgcctgtcttctgaagtg
tctggttctggctctggcaactttggggaggaaggcaatccccagggcaaagaagatcag
gaaggaagcggaggtgactacatgcctatgaacaattggggctcaggaaatggccggggc
tcaggaggtggccagggctcaaatggccaaggctccagtagccatagctcgggaggaaac
cagtgttcaggcgagggacagggatcccgaggtggtcagggctcaaatggccagggctca
ggaggaaaccagtgctctagagatggccagggcaccgcaggtgggcacggttcaggtggt
ggccagagacctggaggtgggcatggctcaggtggtggccagggacctggagatggccat
ggctcaggtggtggcaagaactctggggggggcaaaggctcaggaagtgggaaaggatcc
gatggtgatggtgaacgtggaaaatctctgaagaaaagatcctattttggcaaattaact
caaagcaagcaacagcaaatgccaccacctccaccacctcctcctccacccccaccagct
ggaggaactggtggaaaagggaagtctgggggaagattcagactttatttttgtgttgac
agaggagccacgaaagaatgcaaagaagccaaagaagtgaaagatgcagagatcccagaa
ggtgcagctcgaggtccccacagagccagagcttttgatgaagatgaggatgacccatac
gtgccaatgaggccaggggtggccacccctcttgtaagctccagtgattatatgccaatg
gctcctcaaaatgtctctgcttcaaaaaagcgccactctcgatccccttttgaagattca
agagggtacatgatgatgtttcccagagtgagcccaccacctgctccgagtcctccaaaa
gcacctgatactaataaagaggatgactcaaaggacaatgacagtgagagtgactacatg
tttatggctcctggagccggtgcaattccaaaaaaccccagaaatcctcagggtggctct
tcctccaaaagttggagctcctacttctctctaccaaacccttttcggagctcacctttg
ggacagaatgacaacagtgagtatgtgccaatgttacctggaaagttcctggggaggggc
ctagacaaagaagtctcctataactgggaccccaaagatgcagcttcaaagccttcaggt
gagggatcattctcaaagcctggagatgggggatcaccttcaaagccttcagatcatgag
cccccaaagaataaagctaagagacctaaccgactttcttttattacaaaaggatataaa
atcaagccaaaaccacaaaagcccacacatgagcagagagaagctgacagctctagtgac
tacgtcaacatggacttcactaaaagagagagcaatacaccagctccctctactcaagga
ctaccagattcgtggggcataattgctgaacccagacagtcagccttttctaattatgtg
aatgttgagtttggagtgccatttccaaatccagcaaacgacctctcagatcttttaaga
gctataccacgtgccaaccccttatctctggacagtgctaggtggccacttcctcccctt
cccctcagtgctacaggtagcaatgctattgaggaagagggtgactacattgaagtaatt
ttcaactcagcaatgacaccagccatggctcttgctgacagtgccattcgctatgatgct
gaaacaggtcgaatctatgtggtcgacccattttctgagtgctgtatggatatttctctc
tcccccagccgatgttctgaaccaccacctgtagctaggctgctgcaggaagaagagcag
gagagaagacgcccacaaagccgttctcaaagtttctttgcagcagccagagccgctgtc
tctgcttttccaacagacagcctcgagagagacctttccccatcctcagccccggctgtc
gcttcggctgcagagccgactttagccctcagccaagttgtagctgcggcctccgcgctc
gccgcagccccgggcatcggcgcagcagccgcagctgctggatttgactccgcctctgcc
cgctggtttcaacctgttgctaatgctgctgatgccgaagcagtaaggggagcccaagac
gttgccggtggctcgaaccctggagcccacaacccatctgcaaaccttgccagaggtgat
aaccaggctggcggggctgccgctgcagctgccgctccggaaccaccacctcgcagtcgc
cgggtgccaagacccccggagagagaagattctgacaacgacgacgacactcacgtgaga
atggattttgccagacgtgataatcagttcgactctcccaaaagaggtcggtaa

DBGET integrated database retrieval system