KEGG   Homo sapiens (human): 84787Help
Entry
84787             CDS       T01001                                 

Gene name
SUV420H2, KMT5C
Definition
suppressor of variegation 4-20 homolog 2 (Drosophila) (EC:2.1.1.43)
Orthology
K11429  
histone-lysine N-methyltransferase SUV420H [EC:2.1.1.43]
Organism
hsa  Homo sapiens (human)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    84787 (SUV420H2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     84787 (SUV420H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.42
AA seq 462 aa AA seqDB search
MGPDRVTARELCENDDLATSLVLDPYLGFRTHKMNVSPVPPLRRQQHLRSALETFLRQRD
LEAAYRALTLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMETNG
AKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAF
INHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEGFFGEKNEHCECHTCERKGEG
AFRTRPREPALPPRPLDKYQLRETKRRLQQGLDSGSRQGLLGPRACVHPSPLRRDPFCAA
CQPLRLPACSARPDTSPLWLQWLPQPQPRVRPRKRRRPRPRRAPVLSTHHAARVSLHRWG
GCGPHCRLRGEALVALGQPPHARWAPQQDWHWARRYGLPYVVRVDLRRLAPAPPATPAPA
GTPGPILIPKQALAFAPFSPPKRLRLVVSHGSIDLDVGGEEL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggggcccgacagagtgacagcacgagaactgtgcgagaacgacgacctggccaccagc
ctcgtcctggacccctacctcggtttccgcacccataagatgaacgtcagccctgtgccc
cccctgcggcgacagcagcacctgcgctcagcgctggaaactttcctgaggcagcgggac
ctggaggctgcgtaccgggccctgacgctgggaggctggacggcccgctacttccagagc
cggggcccgcggcaggaggctgccctcaagacccacgtctatcgctacctccgtgccttc
ctgccggaaagtggctttaccatcctgccctgcacgcgctactccatggagaccaacggg
gccaagatcgtgtccactcgtgcttggaaaaagaatgagaagctggagctgctggtgggc
tgcattgcagagctgcgggaggcagatgaggggctgctgagggccggtgagaatgacttc
agcatcatgtactcaacccgcaagcggagtgctcagctgtggctgggcccagccgccttc
atcaaccatgactgcaaacccaactgcaagtttgtgcctgcagatgggaacgcagcctgc
gtgaaggtgctccgggacattgagcctggggacgaggtgacatgcttctacggcgagggc
ttcttcggcgagaagaatgagcactgtgaatgccacacctgtgagaggaaaggtgaagga
gctttccgaaccaggcctagggagcccgcgttgccaccacggcccctggacaagtaccag
ctgcgtgagaccaagcggcggctgcagcaaggcctggacagtggcagccgacagggcctg
ctgggccctcgggcctgcgtgcacccatccccgctgcgccgggacccattctgcgccgcc
tgccagcccctgcgcctgccagcctgcagcgcccgcccagacacctcacccctctggctc
cagtggctgcctcagccccagccccgagtgcggccccggaagcgccgacgcccccggccc
cggagggccccagtgctctccacccaccacgctgcccgcgtctccctgcaccgatgggga
ggctgtggcccccactgccgcctgcgaggagaggccctggtggccctgggccagcccccc
cacgcccgctgggcccctcagcaggactggcactgggcccggcgctatgggctgccttac
gtggtgcgtgtggaccttcgtcgcctggccccagccccaccagctaccccagcccctgct
gggaccccaggccccatcctgatcccgaagcaggccctcgccttcgcccccttctcccca
cccaagcgcctacggctggtggtcagccacggctccatcgacctggatgtcggcggtgaa
gagctgtga

DBGET integrated database retrieval system