KEGG   Homo sapiens (human): 8480Help
Entry
8480              CDS       T01001                                 

Gene name
RAE1, MIG14, MRNP41, Mnrp41, dJ481F12.3, dJ800J21.1
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
Human Diseases; Infectious diseases; Influenza A [PATH:hsa05164]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
20q13.31
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtttggaacaacctcaggttttggaaccagtgggaccagcatgtttggcagt
gcaactacagacaatcacaatcccatgaaggatattgaagtaacatcatctcctgatgat
agcattggttgtctgtcttttagcccaccaaccttgccggggaactttcttattgcagga
tcatgggctaatgatgttcgctgctgggaagttcaagacagtggacagaccattccaaaa
gcccagcagatgcacactgggcctgtgcttgatgtctgctggagtgacgatgggagcaaa
gtgtttacggcatcgtgtgataaaactgccaaaatgtgggacctcagcagtaaccaagcg
atacagatcgcacagcatgatgctcctgttaaaaccatccattggatcaaagctccaaac
tacagctgtgtgatgactgggagctgggataagactttaaagttttgggatactcgatcg
tcaaatcctatgatggttttgcaactccctgaaaggtgttactgtgctgacgtgatatac
cccatggctgtggtggcaactgcagagaggggcctgattgtctatcagctagagaatcaa
ccttctgaattcaggaggatagaatctccactgaaacatcagcatcggtgtgtggctatt
tttaaagacaaacagaacaagcctactggttttgccctgggaagtatcgaggggagagtt
gctattcactatatcaaccccccgaaccccgccaaagataacttcacctttaaatgtcat
cgatctaatggaaccaacacttcagctcctcaggacatttatgcggtaaatggaatcgcg
ttccatcctgttcatggcacccttgcaactgtgggatctgatggtagattcagcttctgg
gacaaagatgccagaacaaaactaaaaacttcggaacagttagatcagcccatctcagct
tgctgtttcaatcacaatggaaacatatttgcatacgcttccagctacgactggtcaaag
ggacatgaattttataatccccagaaaaaaaattacattttcctgcgtaatgcagccgaa
gagctaaagcccaggaataagaagtag

DBGET integrated database retrieval system