KEGG   Homo sapiens (human): 84803Help
Entry
84803             CDS       T01001                                 

Gene name
AGPAT9, AGPAT_10, AGPAT8, GPAT3, LPAAT-theta, MAG1
Definition
1-acylglycerol-3-phosphate O-acyltransferase 9 (EC:2.3.1.51 2.3.1.15)
Orthology
K13506  
glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    84803 (AGPAT9)
   00564 Glycerophospholipid metabolism
    84803 (AGPAT9)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     84803 (AGPAT9)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  GPAT
   84803 (AGPAT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q21.23
AA seq 434 aa AA seqDB search
MEGAELAGKILSTWLTLVLGFILLPSVFGVSLGISEIYMKILVKTLEWATIRIEKGTPKE
SILKNSASVGIIQRDESPMEKGLSGLRGRDFELSDVFYFSKKGLEAIVEDEVTQRFSSEE
LVSWNLLTRTNVNFQYISLRLTMVWVLGVIVRYCVLLPLRVTLAFIGISLLVIGTTLVGQ
LPDSSLKNWLSELVHLTCCRICVRALSGTIHYHNKQYRPQKGGICVANHTSPIDVLILTT
DGCYAMVGQVHGGLMGIIQRAMVKACPHVWFERSEMKDRHLVTKRLKEHIADKKKLPILI
FPEGTCINNTSVMMFKKGSFEIGGTIHPVAIKYNPQFGDAFWNSSKYNMVSYLLRMMTSW
AIVCDVWYMPPMTREEGEDAVQFANRVKSAIAIQGGLTELPWDGGLKRAKVKDIFKEEQQ
KNYSKMIVGNGSLS
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgcagagctggccgggaagatcctttccacctggctgacgctggttctcggc
ttcatccttttaccttcggtcttcggagtgtctctgggcatctccgagatctacatgaag
atcctagtgaaaactttagagtgggccacaatacgaattgaaaaaggaaccccaaaggag
tcgattcttaaaaactctgcttctgttggtattatccaaagagatgagtcacccatggaa
aaagggctctctggtctacgaggaagggactttgagctgtctgacgtgttttatttctcc
aagaagggattggaagccattgtagaagatgaagtgacccagaggttttcctcagaggag
ctagtgtcatggaatctcctcacaagaaccaatgtaaatttccagtacatcagtctgcgg
ctcactatggtgtgggtgctgggcgtcatagtgcgctattgtgtcctactgcctctgagg
gttaccttggctttcattgggatcagtttgctggttataggaactacactggttgggcag
ctgccagacagcagcctcaaaaactggctgagtgaactggtccatctgacttgctgccgg
atctgtgtgcgagccctctctggtaccattcattatcataacaagcagtacagaccccag
aagggaggcatttgtgttgccaaccatacttcccccattgatgttttaatcttgacaacg
gatggatgttatgctatggttggccaggttcatggcggcttgatgggaattattcagaga
gctatggtcaaggcttgtcctcatgtctggtttgaacgctcagaaatgaaggatcgacac
ctggttactaagagactaaaagaacatattgctgataagaagaaactacccatactaatt
tttcctgaaggaacttgcatcaacaatacttcagtcatgatgtttaaaaaggggagcttt
gaaattggaggaaccatacatccagttgcaattaagtataaccctcagttcggtgatgca
ttttggaacagtagtaaatacaacatggtgagctacctgcttcgaatgatgaccagctgg
gccatcgtctgtgacgtgtggtacatgccccccatgaccagagaggaaggagaagatgca
gtccagtttgctaacagggttaagtctgctattgctatacaaggaggcctgactgaactt
ccctgggatggaggactaaagagagcaaaggtgaaggacatctttaaggaagagcagcag
aaaaattacagcaagatgattgtgggcaatggatctctcagctaa

DBGET integrated database retrieval system