KEGG   Homo sapiens (human): 8482Help
Entry
8482              CDS       T01001                                 

Gene name
SEMA7A, CD108, CDw108, H-SEMA-K1, H-Sema-L, JMH, SEMAK1, SEMAL
Definition
(RefSeq) semaphorin 7A (John Milton Hagen blood group)
  KO
K06529  
semaphorin 7
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    8482 (SEMA7A)
Cell adhesion molecules and their ligands [BR:hsa04516]
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
     8482 (SEMA7A)
 7. Others
  PLXNC; plexin C [KO:K06572]
   8482 (SEMA7A)
Cellular antigens [BR:hsa04090]
 Proteins
  8482 (SEMA7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22.3-q23
AA seq 666 aa AA seqDB search
MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKG
HVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSC
LDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLV
LFEGDEVYSTIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKI
YYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNF
NRLQDVFLLPDPSGQWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPN
PRPGKCLPDQQPIPTETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASH
GETFHVLYLTTDRGTIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVS
SQWEVSQVPLDLCEVYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKE
CPNPKPDKAPLQKVSLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFI
ENLTAQQYGHYFCEAQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLT
LGLLVH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctcctccgcccggacgtgccgcccccagcgcaccgcgcgcccgcgtccctggc
ccgccggctcggttggggcttccgctgcggctgcggctgctgctgctgctctgggcggcc
gccgcctccgcccagggccacctaaggagcggaccccgcatcttcgccgtctggaaaggc
catgtagggcaggaccgggtggactttggccagactgagccgcacacggtgcttttccac
gagccaggcagctcctctgtgtgggtgggaggacgtggcaaggtctacctctttgacttc
cccgagggcaagaacgcatctgtgcgcacggtgaatatcggctccacaaaggggtcctgt
ctggataagcgggactgcgagaactacatcactctcctggagaggcggagtgaggggctg
ctggcctgtggcaccaacgcccggcaccccagctgctggaacctggtgaatggcactgtg
gtgccacttggcgagatgagaggctacgcccccttcagcccggacgagaactccctggtt
ctgtttgaaggggacgaggtgtattccaccatccggaagcaggaatacaatgggaagatc
cctcggttccgccgcatccggggcgagagtgagctgtacaccagtgatactgtcatgcag
aacccacagttcatcaaagccaccatcgtgcaccaagaccaggcttacgatgacaagatc
tactacttcttccgagaggacaatcctgacaagaatcctgaggctcctctcaatgtgtcc
cgtgtggcccagttgtgcaggggggaccagggtggggaaagttcactgtcagtctccaag
tggaacacttttctgaaagccatgctggtatgcagtgatgctgccaccaacaagaacttc
aacaggctgcaagacgtcttcctgctccctgaccccagcggccagtggagggacaccagg
gtctatggtgttttctccaacccctggaactactcagccgtctgtgtgtattccctcggt
gacattgacaaggtcttccgtacctcctcactcaagggctaccactcaagccttcccaac
ccgcggcctggcaagtgcctcccagaccagcagccgatacccacagagaccttccaggtg
gctgaccgtcacccagaggtggcgcagagggtggagcccatggggcctctgaagacgcca
ttgttccactctaaataccactaccagaaagtggccgtccaccgcatgcaagccagccac
ggggagacctttcatgtgctttacctaactacagacaggggcactatccacaaggtggtg
gaaccgggggagcaggagcacagcttcgccttcaacatcatggagatccagcccttccgc
cgcgcggctgccatccagaccatgtcgctggatgctgagcggaggaagctgtatgtgagc
tcccagtgggaggtgagccaggtgcccctggacctgtgtgaggtctatggcgggggctgc
cacggttgcctcatgtcccgagacccctactgcggctgggaccaaggccgctgcatctcc
atctacagctccgaacggtcagtgctgcaatccattaatccagccgagccacacaaggag
tgtcccaaccccaaaccagacaaggccccactgcagaaggtttccctggccccaaactct
cgctactacctgagctgccccatggaatcccgccacgccacctactcatggcgccacaag
gagaacgtggagcagagctgcgaacctggtcaccagagccccaactgcatcctgttcatc
gagaacctcacggcgcagcagtacggccactacttctgcgaggcccaggagggctcctac
ttccgcgaggctcagcactggcagctgctgcccgaggacggcatcatggccgagcacctg
ctgggtcatgcctgtgccctggccgcctccctctggctgggggtgctgcccacactcact
cttggcttgctggtccactag

DBGET integrated database retrieval system