KEGG   Homo sapiens (human): 8482Help
Entry
8482              CDS       T01001                                 

Gene name
SEMA7A, CD108, CDw108, H-SEMA-K1, H-Sema-L, JMH, SEMAK1, SEMAL
Definition
semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group)
Orthology
K06529  
semaphorin 7
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    8482 (SEMA7A)
Cellular antigens [BR:hsa04090]
 Proteins
  8482 (SEMA7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22.3-q23
AA seq 652 aa AA seqDB search
MTPPPPGRAAPSAPRARVPGPPARLGLPLRLRLLLLLWAAAASAQGHLRSGPRIFAVWKG
HVGQDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTDCENYITLLE
RRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGDEVYSTIRKQ
EYNGKIPRFRRIRGESELYTSDTVMQNPQFIKATIVHQDQAYDDKIYYFFREDNPDKNPE
APLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAMLVCSDAATNKNFNRLQDVFLLPDPSG
QWRDTRVYGVFSNPWNYSAVCVYSLGDIDKVFRTSSLKGYHSSLPNPRPGKCLPDQQPIP
TETFQVADRHPEVAQRVEPMGPLKTPLFHSKYHYQKVAVHRMQASHGETFHVLYLTTDRG
TIHKVVEPGEQEHSFAFNIMEIQPFRRAAAIQTMSLDAERRKLYVSSQWEVSQVPLDLCE
VYGGGCHGCLMSRDPYCGWDQGRCISIYSSERSVLQSINPAEPHKECPNPKPDKAPLQKV
SLAPNSRYYLSCPMESRHATYSWRHKENVEQSCEPGHQSPNCILFIENLTAQQYGHYFCE
AQEGSYFREAQHWQLLPEDGIMAEHLLGHACALAASLWLGVLPTLTLGLLVH
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctcctccgcccggacgtgccgcccccagcgcaccgcgcgcccgcgtccctggc
ccgccggctcggttggggcttccgctgcggctgcggctgctgctgctgctctgggcggcc
gccgcctccgcccagggccacctaaggagcggaccccgcatcttcgccgtctggaaaggc
catgtagggcaggaccgggtggactttggccagactgagccgcacacggtgcttttccac
gagccaggcagctcctctgtgtgggtgggaggacgtggcaaggtctacctctttgacttc
cccgagggcaagaacgcatctgtgcgcacggactgcgagaactacatcactctcctggag
aggcggagtgaggggctgctggcctgtggcaccaacgcccggcaccccagctgctggaac
ctggtgaatggcactgtggtgccacttggcgagatgagaggctacgcccccttcagcccg
gacgagaactccctggttctgtttgaaggggacgaggtgtattccaccatccggaagcag
gaatacaatgggaagatccctcggttccgccgcatccggggcgagagtgagctgtacacc
agtgatactgtcatgcagaacccacagttcatcaaagccaccatcgtgcaccaagaccag
gcttacgatgacaagatctactacttcttccgagaggacaatcctgacaagaatcctgag
gctcctctcaatgtgtcccgtgtggcccagttgtgcaggggggaccagggtggggaaagt
tcactgtcagtctccaagtggaacacttttctgaaagccatgctggtatgcagtgatgct
gccaccaacaagaacttcaacaggctgcaagacgtcttcctgctccctgaccccagcggc
cagtggagggacaccagggtctatggtgttttctccaacccctggaactactcagccgtc
tgtgtgtattccctcggtgacattgacaaggtcttccgtacctcctcactcaagggctac
cactcaagccttcccaacccgcggcctggcaagtgcctcccagaccagcagccgataccc
acagagaccttccaggtggctgaccgtcacccagaggtggcgcagagggtggagcccatg
gggcctctgaagacgccattgttccactctaaataccactaccagaaagtggccgtccac
cgcatgcaagccagccacggggagacctttcatgtgctttacctaactacagacaggggc
actatccacaaggtggtggaaccgggggagcaggagcacagcttcgccttcaacatcatg
gagatccagcccttccgccgcgcggctgccatccagaccatgtcgctggatgctgagcgg
aggaagctgtatgtgagctcccagtgggaggtgagccaggtgcccctggacctgtgtgag
gtctatggcgggggctgccacggttgcctcatgtcccgagacccctactgcggctgggac
caaggccgctgcatctccatctacagctccgaacggtcagtgctgcaatccattaatcca
gccgagccacacaaggagtgtcccaaccccaaaccagacaaggccccactgcagaaggtt
tccctggccccaaactctcgctactacctgagctgccccatggaatcccgccacgccacc
tactcatggcgccacaaggagaacgtggagcagagctgcgaacctggtcaccagagcccc
aactgcatcctgttcatcgagaacctcacggcgcagcagtacggccactacttctgcgag
gcccaggagggctcctacttccgcgaggctcagcactggcagctgctgcccgaggacggc
atcatggccgagcacctgctgggtcatgcctgtgccctggccgcctccctctggctgggg
gtgctgcccacactcactcttggcttgctggtccactag

DBGET integrated database retrieval system