KEGG   Homo sapiens (human): 84823Help
Entry
84823             CDS       T01001                                 

Gene name
LMNB2, EPM9, LAMB2, LMN2
Definition
(RefSeq) lamin B2
  KO
K07611  lamin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Disease
H00420  Familial partial lipodystrophy (FPL)
H00810  Progressive myoclonic epilepsy (PME/ EPM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    84823 (LMNB2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     84823 (LMNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament LTD BRE1 FPP
Motif
Other DBs
NCBI-GeneID: 84823
NCBI-ProteinID: NP_116126
OMIM: 150341
HGNC: 6638
Ensembl: ENSG00000176619
Vega: OTTHUMG00000150626
Pharos: Q03252(Tbio)
UniProt: Q03252
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 620 aa AA seqDB search
MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHY
IDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIE
IGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAEL
RAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERR
LVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAA
SAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEM
TEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSS
SSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEID
LEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAH
SPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGE
EDLFHQQGDPRTTSRGCYVM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgccgagcccgggccgccgtcgggagcagcgcaggccgcgagccgccgccacc
atggccacgccgctgcccggccgcgcgggcgggcccgccacgccgctgtcgcccacgcgc
ctgtcgcggctgcaggagaaggaggagctgcgcgagctcaacgaccgcctggcgcactac
atcgaccgcgtccgcgcgctggagctggagaacgaccggctcctgctcaagatctcagag
aaggaggaggtgaccacgcgcgaggtgagtggcatcaaggcgctgtacgagtcggagctg
gccgatgcccggagagtcctggatgagacggctcgagagcgtgcccggctgcagatagag
attgggaagctgagggcagagttggacgaggtcaacaagagcgccaagaagagggagggc
gagcttacggtggcccagggccgtgtgaaggacctggagtccctgttccaccggagcgag
gtggagctggcagctgccctcagcgacaagcgcggcctggagagtgacgtggctgagctg
cgggcccagctggccaaggccgaggacggtcatgcagtggccaaaaagcagctggagaag
gagacgctgatgcgtgtggacctggagaaccgctgccagagcctgcaggaggagctggac
ttccggaagagtgtgttcgaggaggaggtgcgggagacgcggcggcggcacgagcggcgc
ctggtggaggtggacagcagccggcagcaggagtacgacttcaagatggcacaggcgctg
gaggagctgcggagccagcacgacgagcaagtgcggctctacaagctggagctggagcag
acctaccaggccaagctggacagcgccaagctgagctctgaccagaacgacaaggcggcc
agtgcggctcgcgaggagctgaaggaggcccgcatgcgcctggagtccctcagctaccag
ctctccggcctccagaagcaggccagtgccgctgaagatcgcattcgggagctggaggag
gccatggccggggagcgggacaagttccggaagatgctggacgccaaggagcaggagatg
acggagatgcgggacgtgatgcagcagcagctggccgagtaccaggagctgctggacgtg
aagctggccctggacatggagatcaacgcctaccggaagctcctggagggcgaggaggag
aggctgaagctgtcccccagcccatcctcgcgcgtcaccgtctcacgagccacctcgagc
agcagcggcagcttgtccgccaccgggcgcctgggccgcagtaagcggaagcggctggag
gtggaggagcccttgggcagcggcccaagcgtcctgggcacgggcacgggtggcagcggt
ggcttccacctggcccagcaggcctcggcctcgggtagcgtcagcatcgaggagatcgac
ctggagggcaagtttgtgcagctcaagaacaactcggacaaggatcagtctctggggaac
tggagaatcaagaggcaggtcttggagggggaggagatcgcctacaagttcacgcccaag
tacatcctgcgcgccggccagatggtcacggtgtgggcagctggtgcgggggtggcccac
agccccccctcgacgctggtgtggaagggccagagcagctggggcacgggcgagagcttc
cgcaccgtcctggttaacgcggatggcgaggaagtggccatgaggactgtgaagaagtcc
tcggtgatgcgtgagaatgagaatggggaggaagaggaggaggaagccgagtttggcgag
gaggatcttttccaccaacagggggacccgaggaccacctcaagaggctgctacgtgatg
tga

DBGET integrated database retrieval system