KEGG   Homo sapiens (human): 84823Help
Entry
84823             CDS       T01001                                 

Gene name
LMNB2, LAMB2, LMN2
Definition
lamin B2
Orthology
K07611  
lamin B
Organism
hsa  Homo sapiens (human)
Disease
H00420  
Familial partial lipodystrophy (FPL)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13.3
AA seq 620 aa AA seqDB search
MSPPSPGRRREQRRPRAAATMATPLPGRAGGPATPLSPTRLSRLQEKEELRELNDRLAHY
IDRVRALELENDRLLLKISEKEEVTTREVSGIKALYESELADARRVLDETARERARLQIE
IGKLRAELDEVNKSAKKREGELTVAQGRVKDLESLFHRSEVELAAALSDKRGLESDVAEL
RAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELDFRKSVFEEEVRETRRRHERR
LVEVDSSRQQEYDFKMAQALEELRSQHDEQVRLYKLELEQTYQAKLDSAKLSSDQNDKAA
SAAREELKEARMRLESLSYQLSGLQKQASAAEDRIRELEEAMAGERDKFRKMLDAKEQEM
TEMRDVMQQQLAEYQELLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRATSS
SSGSLSATGRLGRSKRKRLEVEEPLGSGPSVLGTGTGGSGGFHLAQQASASGSVSIEEID
LEGKFVQLKNNSDKDQSLGNWRIKRQVLEGEEIAYKFTPKYILRAGQMVTVWAAGAGVAH
SPPSTLVWKGQSSWGTGESFRTVLVNADGEEVAMRTVKKSSVMRENENGEEEEEEAEFGE
EDLFHQQGDPRTTSRGCYVM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgccgagcccgggccgccgtcgggagcagcgcaggccgcgagccgccgccacc
atggccacgccgctgcccggccgcgcgggcgggcccgccacgccgctgtcgcccacgcgc
ctgtcgcggctgcaggagaaggaggagctgcgcgagctcaacgaccgcctggcgcactac
atcgaccgcgtccgcgcgctggagctggagaacgaccggctcctgctcaagatctcagag
aaggaggaggtgaccacgcgcgaggtgagtggcatcaaggcgctgtacgagtcggagctg
gccgatgcccggagagtcctggatgagacggctcgagagcgtgcccggctgcagatagag
attgggaagctgagggcagagttggacgaggtcaacaagagcgccaagaagagggagggc
gagcttacggtggcccagggccgtgtgaaggacctggagtccctgttccaccggagcgag
gtggagctggcagctgccctcagcgacaagcgcggcctggagagtgacgtggctgagctg
cgggcccagctggccaaggccgaggacggtcatgcagtggccaaaaagcagctggagaag
gagacgctgatgcgtgtggacctggagaaccgctgccagagcctgcaggaggagctggac
ttccggaagagtgtgttcgaggaggaggtgcgggagacgcggcggcggcacgagcggcgc
ctggtggaggtggacagcagccggcagcaggagtacgacttcaagatggcacaggcgctg
gaggagctgcggagccagcacgacgagcaagtgcggctctacaagctggagctggagcag
acctaccaggccaagctggacagcgccaagctgagctctgaccagaacgacaaggcggcc
agtgcggctcgcgaggagctgaaggaggcccgcatgcgcctggagtccctcagctaccag
ctctccggcctccagaagcaggccagtgccgctgaagatcgcattcgggagctggaggag
gccatggccggggagcgggacaagttccggaagatgctggacgccaaggagcaggagatg
acggagatgcgggacgtgatgcagcagcagctggccgagtaccaggagctgctggacgtg
aagctggccctggacatggagatcaacgcctaccggaagctcctggagggcgaggaggag
aggctgaagctgtcccccagcccatcctcgcgcgtcaccgtctcacgagccacctcgagc
agcagcggcagcttgtccgccaccgggcgcctgggccgcagtaagcggaagcggctggag
gtggaggagcccttgggcagcggcccaagcgtcctgggcacgggcacgggtggcagcggt
ggcttccacctggcccagcaggcctcggcctcgggtagcgtcagcatcgaggagatcgac
ctggagggcaagtttgtgcagctcaagaacaactcggacaaggatcagtctctggggaac
tggagaatcaagaggcaggtcttggagggggaggagatcgcctacaagttcacgcccaag
tacatcctgcgcgccggccagatggtcacggtgtgggcagctggtgcgggggtggcccac
agccccccctcgacgctggtgtggaagggccagagcagctggggcacgggcgagagcttc
cgcaccgtcctggttaacgcggatggcgaggaagtggccatgaggactgtgaagaagtcc
tcggtgatgcgtgagaatgagaatggggaggaagaggaggaggaagccgagtttggcgag
gaggatcttttccaccaacagggggacccgaggaccacctcaagaggctgctacgtgatg
tga

DBGET integrated database retrieval system