KEGG   Homo sapiens (human): 8484Help
Entry
8484              CDS       T01001                                 

Gene name
GALR3
Definition
(RefSeq) galanin receptor 3
  KO
K04232  
galanin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8484 (GALR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Galanin [OT]
    8484 (GALR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q13.1
AA seq 368 aa AA seqDB search
MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
GEAARGPE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcccagaacatttcactggacagcccagggagtgtgggggccgtggcagtg
cctgtggtctttgccctaatcttcctgctgggcacagtgggcaatgggctggtgctggca
gtgctcctgcagcctggcccgagtgcctggcaggagcctggcagcaccacggacctgttc
atcctcaacctggcggtggctgacctctgcttcatcctgtgctgcgtgcccttccaggcc
accatctacacgctggatgcctggctctttggggccctcgtctgcaaggccgtgcacctg
ctcatctacctcaccatgtacgccagcagctttacgctggctgctgtctccgtggacagg
tacctggccgtgcggcacccgctgcgctcgcgcgccctgcgcacgccgcgtaacgcccgc
gccgcagtggggctggtgtggctgctggcggcgctcttctcggcgccctacctcagctac
tacggcaccgtgcgctacggcgcgctggagctctgcgtgcccgcctgggaggacgcgcgc
cgccgcgccctggacgtggccaccttcgctgccggctacctgctgcccgtggctgtggtg
agcctggcctacgggcgcacgctgcgcttcctgtgggccgccgtgggtcccgcgggcgcg
gcggcggccgaggcgcggcggagggcgacgggccgcgcggggcgcgccatgctggcggtg
gccgcgctctacgcgctctgctggggtccgcaccacgcgctcatcctgtgcttctggtac
ggccgcttcgccttcagcccggccacctacgcctgccgcctggcctcacactgcctggcc
tacgccaactcctgcctcaacccgctcgtctacgcgctcgcctcgcgccacttccgcgcg
cgcttccgccgcctgtggccgtgcggccgccgacgccgccaccgtgcccgccgcgccttg
cgtcgcgtccgccccgcgtcctcgggcccacccggctgccccggagacgcccggcctagc
gggaggctgctggctggtggcggccagggcccggagcccagggagggacccgtccacggc
ggagaggctgcccgaggaccggaataa

DBGET integrated database retrieval system