KEGG   Homo sapiens (human): 8484Help
Entry
8484              CDS       T01001                                 

Gene name
GALR3
Definition
(RefSeq) galanin receptor 3
  KO
K04232  galanin receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8484 (GALR3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Neuropeptide
   Galanin [OT]
    8484 (GALR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srv 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 8484
NCBI-ProteinID: NP_003605
OMIM: 603692
HGNC: 4134
Ensembl: ENSG00000128310
Vega: OTTHUMG00000150658
Pharos: O60755(Tchem)
UniProt: O60755
Position
22q13.1
AA seq 368 aa AA seqDB search
MADAQNISLDSPGSVGAVAVPVVFALIFLLGTVGNGLVLAVLLQPGPSAWQEPGSTTDLF
ILNLAVADLCFILCCVPFQATIYTLDAWLFGALVCKAVHLLIYLTMYASSFTLAAVSVDR
YLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGTVRYGALELCVPAWEDAR
RRALDVATFAAGYLLPVAVVSLAYGRTLRFLWAAVGPAGAAAAEARRRATGRAGRAMLAV
AALYALCWGPHHALILCFWYGRFAFSPATYACRLASHCLAYANSCLNPLVYALASRHFRA
RFRRLWPCGRRRRHRARRALRRVRPASSGPPGCPGDARPSGRLLAGGGQGPEPREGPVHG
GEAARGPE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcccagaacatttcactggacagcccagggagtgtgggggccgtggcagtg
cctgtggtctttgccctaatcttcctgctgggcacagtgggcaatgggctggtgctggca
gtgctcctgcagcctggcccgagtgcctggcaggagcctggcagcaccacggacctgttc
atcctcaacctggcggtggctgacctctgcttcatcctgtgctgcgtgcccttccaggcc
accatctacacgctggatgcctggctctttggggccctcgtctgcaaggccgtgcacctg
ctcatctacctcaccatgtacgccagcagctttacgctggctgctgtctccgtggacagg
tacctggccgtgcggcacccgctgcgctcgcgcgccctgcgcacgccgcgtaacgcccgc
gccgcagtggggctggtgtggctgctggcggcgctcttctcggcgccctacctcagctac
tacggcaccgtgcgctacggcgcgctggagctctgcgtgcccgcctgggaggacgcgcgc
cgccgcgccctggacgtggccaccttcgctgccggctacctgctgcccgtggctgtggtg
agcctggcctacgggcgcacgctgcgcttcctgtgggccgccgtgggtcccgcgggcgcg
gcggcggccgaggcgcggcggagggcgacgggccgcgcggggcgcgccatgctggcggtg
gccgcgctctacgcgctctgctggggtccgcaccacgcgctcatcctgtgcttctggtac
ggccgcttcgccttcagcccggccacctacgcctgccgcctggcctcacactgcctggcc
tacgccaactcctgcctcaacccgctcgtctacgcgctcgcctcgcgccacttccgcgcg
cgcttccgccgcctgtggccgtgcggccgccgacgccgccaccgtgcccgccgcgccttg
cgtcgcgtccgccccgcgtcctcgggcccacccggctgccccggagacgcccggcctagc
gggaggctgctggctggtggcggccagggcccggagcccagggagggacccgtccacggc
ggagaggctgcccgaggaccggaataa

DBGET integrated database retrieval system