KEGG   Homo sapiens (human): 84867Help
Entry
84867             CDS       T01001                                 

Gene name
PTPN5, PTPSTEP, STEP
Definition
protein tyrosine phosphatase, non-receptor type 5 (striatum-enriched) (EC:3.1.3.48)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11p15.1
AA seq 533 aa AA seqDB search
MNYEGARSERENHAADDSEGGALDMCCSERLPGLPQPIVMEALDEAEGLQDSQREMPPPP
PPSPPSDPAQKPPPRGAGSHSLTVRSSLCLFAASQFLLEPTAWLDSGTWGVPSLLLVFLS
VGLVLVTTLVWHLLRTPPEPPTPLPPEDRRQSVSRQPSFTYSEWMEEKIEDDFLDLDPVP
ETPVFDCVMDIKPEADPTSLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFGYLMSPREE
SAREYLLSASRVLQAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVRKNRYKTIL
PNPHSRVCLTSPDPDDPLSSYINANYIRGYGGEEKVYIATQGPIVSTVADFWRMVWQEHT
PIIVMITNIEEMNEKCTEYWPEEQVAYDGVEITVQKVIHTEDYRLRLISLKSGTEERGLK
HYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCAPIIVHCSAGIGRTGCFIATSIC
CQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHVMSLYEKQLSHQSPE
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgagggagccaggagtgagagagagaaccacgctgctgatgactccgaggga
ggggccctggacatgtgctgcagtgagaggctaccgggtctcccccagccgatagtgatg
gaggcactggacgaggctgaagggctccaggactcacagagagagatgccgccaccccct
cctccctcgccgccctcagatccagctcagaagccaccacctcgaggcgctgggagccac
tccctcactgtcaggagcagcctgtgcctgttcgctgcctcacagttcctgctggaaccc
acggcctggcttgactctgggacgtggggagtccccagtctgctgctggtctttctgtcc
gtgggcctggtcctcgttaccaccctggtgtggcacctcctgaggacacccccagagcca
cccaccccactgccccctgaggacaggcgccagtcagtgagccgccagccctccttcacc
tactcagagtggatggaggagaagatcgaggatgacttcctggacctcgacccggtgccc
gagactcctgtgtttgattgtgtgatggacatcaagcctgaggctgaccccacctcactc
accgtcaagtccatgggtctgcaggagaggaggggttccaatgtctccctgaccctggac
atgtgcactccgggctgcaacgaggagggctttggctatctcatgtccccacgtgaggag
tccgcccgcgagtacctgctcagcgcctcccgtgtcctccaagcagaagagcttcatgaa
aaggccctggaccctttcctgctgcaggcggaattctttgaaatccccatgaactttgtg
gatccgaaagagtacgacatccctgggctggtgcggaagaaccggtacaaaaccatactt
cccaaccctcacagcagagtgtgtctgacctcaccagaccctgacgaccctctgagttcc
tacatcaatgccaactacatccggggctatggtggggaggagaaggtgtacatcgccact
cagggacccatcgtcagcacggtcgccgacttctggcgcatggtgtggcaggagcacacg
cccatcattgtcatgatcaccaacatcgaggagatgaacgagaaatgcaccgagtattgg
ccggaggagcaggtggcgtacgacggtgttgagatcactgtgcagaaagtcattcacacg
gaggattaccggctgcgactcatctccctcaagagtgggactgaggagcgaggcctgaag
cattactggttcacatcctggcccgaccagaagaccccagaccgggcccccccactcctg
cacctggtgcgggaggtggaggaggcagcccagcaggaggggccccactgtgcccccatc
atcgtccactgcagtgcagggattgggaggaccggctgcttcattgccaccagcatctgc
tgccagcagctgcggcaggagggtgtggtggacatcctgaagaccacgtgccagctccgt
caggacaggggcggcatgatccagacatgcgagcagtaccagtttgtgcaccacgtcatg
agcctctacgaaaagcagctgtcccaccagtccccagaatga

DBGET integrated database retrieval system