KEGG   Homo sapiens (human): 84876Help
Entry
84876             CDS       T01001                                 

Gene name
ORAI1, CRACM1, IMD9, ORAT1, TMEM142A
Definition
ORAI calcium release-activated calcium modulator 1
Orthology
K16056  
calcium release-activated calcium channel protein 1
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Platelet activation
Primary immunodeficiency
Disease
H00093  
Combined immunodeficiencies (CIDs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    84876 (ORAI1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    84876 (ORAI1)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    84876 (ORAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q24.31
AA seq 301 aa AA seqDB search
MHPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVTYPDWIGQSY
SEVMSLNEHSMQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDADHDYPPGLL
IAFSACTTVLVAVHLFALMISTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFST
VIGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITPGQAAAIAST
TIMVPFGLIFIVFAVHFYRSLVSHKTDRQFQELNELAEFARLQDQLDHRGDHPLTPGSHY
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcatccggagcccgccccgcccccgagccgcagcagtcccgagcttcccccaagcggc
ggcagcaccaccagcggcagccgccggagccgccgccgcagcggggacggggagcccccg
ggggccccgccaccgccgccgtccgccgtcacctacccggactggatcggccagagttac
tccgaggtgatgagcctcaacgagcactccatgcaggcgctgtcctggcgcaagctctac
ttgagccgcgccaagcttaaagcctccagccggacctcggctctgctctccggcttcgcc
atggtggcaatggtggaggtgcagctggacgctgaccacgactacccaccggggctgctc
atcgccttcagtgcctgcaccacagtgctggtggctgtgcacctgtttgcgctcatgatc
agcacctgcatcctgcccaacatcgaggcggtgagcaacgtgcacaatctcaactcggtc
aaggagtccccccatgagcgcatgcaccgccacatcgagctggcctgggccttctccacc
gtcatcggcacgctgctcttcctagctgaggtggtgctgctctgctgggtcaagttcttg
cccctcaagaagcagccaggccagccaaggcccaccagcaagccccccgccagtggcgca
gcagccaacgtcagcaccagcggcatcaccccgggccaggcagctgccatcgcctcgacc
accatcatggtgcccttcggcctgatctttatcgtcttcgccgtccacttctaccgctca
ctggttagccataagactgaccgacagttccaggagctcaacgagctggcggagtttgcc
cgcttacaggaccagctggaccacagaggggaccaccccctgacgcccggcagccactat
gcctag

DBGET integrated database retrieval system